Glucagon-like peptide 2 receptor

Details

Name
Glucagon-like peptide 2 receptor
Synonyms
  • GLP-2 receptor
Gene Name
GLP2R
Organism
Humans
Amino acid sequence
>lcl|BSEQ0011545|Glucagon-like peptide 2 receptor
MKLGSSRAGPGRGSAGLLPGVHELPMGIPAPWGTSPLSFHRKCSLWAPGRPFLTLVLLVS
IKQVTGSLLEETTRKWAQYKQACLRDLLKEPSGIFCNGTFDQYVCWPHSSPGNVSVPCPS
YLPWWSEESSGRAYRHCLAQGTWQTIENATDIWQDDSECSENHSFKQNVDRYALLSTLQL
MYTVGYSFSLISLFLALTLLLFLRKLHCTRNYIHMNLFASFILRTLAVLVKDVVFYNSYS
KRPDNENGWMSYLSEMSTSCRSVQVLLHYFVGANYLWLLVEGLYLHTLLEPTVLPERRLW
PRYLLLGWAFPVLFVVPWGFARAHLENTGCWTTNGNKKIWWIIRGPMMLCVTVNFFIFLK
ILKLLISKLKAHQMCFRDYKYRLAKSTLVLIPLLGVHEILFSFITDDQVEGFAKLIRLFI
QLTLSSFHGFLVALQYGFANGEVKAELRKYWVRFLLARHSGCRACVLGKDFRFLGKCPKK
LSEGDGAEKLRKLQPSLNSGRLLHLAMRGLGELGAQPQQDHARWPRGSSLSECSEGDVTM
ANTMEEILEESEI
Number of residues
553
Molecular Weight
63000.84
Theoretical pI
9.03
GO Classification
Functions
G-protein coupled receptor activity / glucagon receptor activity
Processes
adenylate cyclase-modulating G-protein coupled receptor signaling pathway / cell surface receptor signaling pathway / positive regulation of cell proliferation
Components
integral component of membrane / plasma membrane
General Function
Glucagon receptor activity
Specific Function
This is a receptor for glucagon-like peptide 2. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.
Pfam Domain Function
Transmembrane Regions
174-198 211-235 262-285 300-321 340-362 387-405 418-438
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0011546|Glucagon-like peptide 2 receptor (GLP2R)
ATGAAGCTGGGATCGAGCAGGGCAGGGCCTGGGAGAGGAAGCGCGGGACTCCTGCCTGGC
GTCCACGAGCTGCCCATGGGCATCCCTGCCCCCTGGGGGACCAGTCCTCTCTCCTTCCAC
AGGAAGTGCTCTCTCTGGGCCCCTGGGAGGCCCTTCCTCACTCTGGTCCTGCTGGTTTCC
ATCAAGCAAGTTACAGGATCCCTCCTTGAGGAAACGACTCGGAAGTGGGCTCAGTACAAA
CAGGCATGTCTGAGAGACTTACTCAAGGAACCTTCTGGCATATTTTGTAACGGGACATTT
GATCAGTACGTGTGTTGGCCTCATTCTTCTCCTGGAAATGTCTCTGTACCCTGCCCTTCA
TACTTACCTTGGTGGAGTGAAGAGAGCTCAGGAAGGGCCTACAGACACTGCTTGGCTCAG
GGGACTTGGCAGACGATAGAGAACGCCACGGATATTTGGCAGGATGACTCCGAATGCTCC
GAGAACCACAGCTTCAAGCAAAACGTGGATCGTTATGCCTTGCTGTCAACCTTGCAGCTG
ATGTACACCGTGGGATACTCCTTCTCTCTTATCTCCCTCTTCCTGGCTCTCACCCTCCTC
TTGTTTCTTCGAAAACTCCACTGCACGCGCAACTACATCCACATGAACTTGTTTGCTTCT
TTCATCCTGAGAACCCTGGCTGTACTGGTGAAGGACGTCGTCTTCTACAACTCTTACTCC
AAGAGGCCTGACAATGAGAATGGGTGGATGTCCTACCTGTCAGAGATGTCCACCTCCTGC
CGCTCAGTCCAGGTTCTCTTGCATTACTTTGTGGGTGCCAATTACTTATGGCTGCTGGTT
GAAGGCCTCTACCTCCACACGCTGCTGGAGCCCACAGTGCTTCCTGAGAGGCGGCTGTGG
CCCAGATACCTGCTGTTGGGTTGGGCCTTCCCTGTGCTATTTGTTGTACCCTGGGGTTTC
GCCCGTGCACACCTGGAGAACACAGGGTGCTGGACAACAAATGGGAATAAGAAAATCTGG
TGGATCATCCGAGGACCCATGATGCTCTGTGTAACAGTCAATTTCTTCATCTTCCTGAAA
ATTCTCAAGCTTCTCATTTCTAAGCTCAAAGCTCATCAAATGTGCTTCAGAGATTATAAA
TACAGATTGGCAAAATCAACACTGGTCCTCATTCCTTTATTGGGCGTTCATGAGATCCTC
TTCTCTTTCATCACTGATGATCAAGTTGAAGGATTTGCAAAACTTATACGACTTTTCATT
CAGTTGACACTGAGCTCCTTTCATGGGTTCCTGGTGGCCTTGCAGTATGGTTTTGCCAAT
GGAGAGGTGAAGGCTGAGCTGCGGAAATACTGGGTCCGCTTCTTGCTAGCCCGCCACTCA
GGCTGCAGAGCCTGTGTCCTGGGGAAGGACTTCCGGTTCCTAGGAAAATGTCCCAAGAAG
CTCTCGGAAGGAGATGGCGCTGAGAAGCTTCGGAAGCTGCAGCCCTCACTTAACAGTGGG
CGGCTCCTACATCTAGCCATGCGAGGTCTTGGGGAGCTGGGCGCCCAGCCCCAACAGGAC
CATGCACGCTGGCCCCGGGGCAGCAGCCTGTCCGAGTGCAGTGAGGGGGATGTCACCATG
GCCAACACCATGGAGGAGATTCTGGAAGAGAGTGAGATCTAG
Chromosome Location
17
Locus
17p13.3
External Identifiers
ResourceLink
UniProtKB IDO95838
UniProtKB Entry NameGLP2R_HUMAN
GenBank Protein ID4324491
GenBank Gene IDAF105367
GenAtlas IDGLP2R
HGNC IDHGNC:4325
General References
  1. Munroe DG, Gupta AK, Kooshesh F, Vyas TB, Rizkalla G, Wang H, Demchyshyn L, Yang ZJ, Kamboj RK, Chen H, McCallum K, Sumner-Smith M, Drucker DJ, Crivici A: Prototypic G protein-coupled receptor for the intestinotrophic factor glucagon-like peptide 2. Proc Natl Acad Sci U S A. 1999 Feb 16;96(4):1569-73. [PubMed:9990065]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00040GlucagonapprovedunknownagonistDetails
DB08900TeduglutideapprovedyesagonistDetails