Interleukin-2 receptor subunit alpha
Details
- Name
- Interleukin-2 receptor subunit alpha
- Synonyms
- IL-2 receptor subunit alpha
- IL-2-RA
- IL-2R subunit alpha
- IL2-RA
- p55
- TAC antigen
- Gene Name
- IL2RA
- UniProtKB Entry
- P01589Swiss-Prot
- Organism
- Humans
- NCBI Taxonomy ID
- 9606
- Amino acid sequence
>lcl|BSEQ0018991|Interleukin-2 receptor subunit alpha MDSYLLMWGLLTFIMVPGCQAELCDDDPPEIPHATFKAMAYKEGTMLNCECKRGFRRIKS GSLYMLCTGNSSHSSWDNQCQCTSSATRNTTKQVTPQPEEQKERKTTEMQSPMQPVDQAS LPGHCREPPPWENEATERIYHFVVGQMVYYQCVQGYRALHRGPAESVCKMTHGKTRWTQP QLICTGEMETSQFPGEEKPQASPEGRPESETSCLVTTTDFQIQTEMAATMETSIFTTEYQ VAVAGCVFLLISVLLLSGLTWQRRQRKSRRTI
- Number of residues
- 272
- Molecular Weight
- 30818.915
- Theoretical pI
- 6.49
- GO Classification
- Processesactivated T cell proliferation / interleukin-2-mediated signaling pathway / regulation of CD4-positive, alpha-beta T cell proliferationComponentsinterleukin-2 receptor complex
- General Function
- Receptor for interleukin-2. The receptor is involved in the regulation of immune tolerance by controlling regulatory T cells (TREGs) activity. TREGs suppress the activation and expansion of autoreactive T-cells
- Specific Function
- Interleukin-2 binding
- Pfam Domain Function
- Sushi (PF00084)
- Signal Regions
- 1-21
- Transmembrane Regions
- 241-259
- Cellular Location
- Membrane
- Gene sequence
>lcl|BSEQ0018992|Interleukin-2 receptor subunit alpha (IL2RA) ATGGATTCATACCTGCTGATGTGGGGACTGCTCACGTTCATCATGGTGCCTGGCTGCCAG GCAGAGCTCTGTGACGATGACCCGCCAGAGATCCCACACGCCACATTCAAAGCCATGGCC TACAAGGAAGGAACCATGTTGAACTGTGAATGCAAGAGAGGTTTCCGCAGAATAAAAAGC GGGTCACTCTATATGCTCTGTACAGGAAACTCTAGCCACTCGTCCTGGGACAACCAATGT CAATGCACAAGCTCTGCCACTCGGAACACAACGAAACAAGTGACACCTCAACCTGAAGAA CAGAAAGAAAGGAAAACCACAGAAATGCAAAGTCCAATGCAGCCAGTGGACCAAGCGAGC CTTCCAGGTCACTGCAGGGAACCTCCACCATGGGAAAATGAAGCCACAGAGAGAATTTAT CATTTCGTGGTGGGGCAGATGGTTTATTATCAGTGCGTCCAGGGATACAGGGCTCTACAC AGAGGTCCTGCTGAGAGCGTCTGCAAAATGACCCACGGGAAGACAAGGTGGACCCAGCCC CAGCTCATATGCACAGGTGAAATGGAGACCAGTCAGTTTCCAGGTGAAGAGAAGCCTCAG GCAAGCCCCGAAGGCCGTCCTGAGAGTGAGACTTCCTGCCTCGTCACAACAACAGATTTT CAAATACAGACAGAAATGGCTGCAACCATGGAGACGTCCATATTTACAACAGAGTACCAG GTAGCAGTGGCCGGCTGTGTTTTCCTGCTGATCAGCGTCCTCCTCCTGAGTGGGCTCACC TGGCAGCGGAGACAGAGGAAGAGTAGAAGAACAATCTAG
- Chromosome Location
- 10
- Locus
- 10p15.1
- External Identifiers
Resource Link UniProtKB ID P01589 UniProtKB Entry Name IL2RA_HUMAN GenBank Protein ID 33813 GenBank Gene ID X01057 GeneCard ID IL2RA GenAtlas ID IL2RA HGNC ID HGNC:6008 PDB ID(s) 1Z92, 2B5I, 2ERJ, 3IU3, 3NFP, 6VWU, 6YIO, 7F9W, 7ZMZ KEGG ID hsa:3559 IUPHAR/Guide To Pharmacology ID 1695 NCBI Gene ID 3559 - General References
- Nikaido T, Shimizu A, Ishida N, Sabe H, Teshigawara K, Maeda M, Uchiyama T, Yodoi J, Honjo T: Molecular cloning of cDNA encoding human interleukin-2 receptor. Nature. 1984 Oct 18-24;311(5987):631-5. [Article]
- Leonard WJ, Depper JM, Crabtree GR, Rudikoff S, Pumphrey J, Robb RJ, Kronke M, Svetlik PB, Peffer NJ, Waldmann TA, et al.: Molecular cloning and expression of cDNAs for the human interleukin-2 receptor. Nature. 1984 Oct 18-24;311(5987):626-31. [Article]
- Ishida N, Kanamori H, Noma T, Nikaido T, Sabe H, Suzuki N, Shimizu A, Honjo T: Molecular cloning and structure of the human interleukin 2 receptor gene. Nucleic Acids Res. 1985 Nov 11;13(21):7579-89. [Article]
- Leonard WJ, Depper JM, Kanehisa M, Kronke M, Peffer NJ, Svetlik PB, Sullivan M, Greene WC: Structure of the human interleukin-2 receptor gene. Science. 1985 Nov 8;230(4726):633-9. [Article]
- Deloukas P, Earthrowl ME, Grafham DV, Rubenfield M, French L, Steward CA, Sims SK, Jones MC, Searle S, Scott C, Howe K, Hunt SE, Andrews TD, Gilbert JG, Swarbreck D, Ashurst JL, Taylor A, Battles J, Bird CP, Ainscough R, Almeida JP, Ashwell RI, Ambrose KD, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Bates K, Beasley H, Bray-Allen S, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Cahill P, Camire D, Carter NP, Chapman JC, Clark SY, Clarke G, Clee CM, Clegg S, Corby N, Coulson A, Dhami P, Dutta I, Dunn M, Faulkner L, Frankish A, Frankland JA, Garner P, Garnett J, Gribble S, Griffiths C, Grocock R, Gustafson E, Hammond S, Harley JL, Hart E, Heath PD, Ho TP, Hopkins B, Horne J, Howden PJ, Huckle E, Hynds C, Johnson C, Johnson D, Kana A, Kay M, Kimberley AM, Kershaw JK, Kokkinaki M, Laird GK, Lawlor S, Lee HM, Leongamornlert DA, Laird G, Lloyd C, Lloyd DM, Loveland J, Lovell J, McLaren S, McLay KE, McMurray A, Mashreghi-Mohammadi M, Matthews L, Milne S, Nickerson T, Nguyen M, Overton-Larty E, Palmer SA, Pearce AV, Peck AI, Pelan S, Phillimore B, Porter K, Rice CM, Rogosin A, Ross MT, Sarafidou T, Sehra HK, Shownkeen R, Skuce CD, Smith M, Standring L, Sycamore N, Tester J, Thorpe A, Torcasso W, Tracey A, Tromans A, Tsolas J, Wall M, Walsh J, Wang H, Weinstock K, West AP, Willey DL, Whitehead SL, Wilming L, Wray PW, Young L, Chen Y, Lovering RC, Moschonas NK, Siebert R, Fechtel K, Bentley D, Durbin R, Hubbard T, Doucette-Stamm L, Beck S, Smith DR, Rogers J: The DNA sequence and comparative analysis of human chromosome 10. Nature. 2004 May 27;429(6990):375-81. [Article]
- Cross SL, Feinberg MB, Wolf JB, Holbrook NJ, Wong-Staal F, Leonard WJ: Regulation of the human interleukin-2 receptor alpha chain promoter: activation of a nonfunctional promoter by the transactivator gene of HTLV-I. Cell. 1987 Apr 10;49(1):47-56. [Article]
- Miedel MC, Hulmes JD, Weber DV, Bailon P, Pan YC: Structural analysis of recombinant soluble human interleukin-2 receptor. Primary structure, assignment of disulfide bonds and core IL-2 binding structure. Biochem Biophys Res Commun. 1988 Jul 15;154(1):372-9. [Article]
- Bamborough P, Hedgecock CJ, Richards WG: The interleukin-2 and interleukin-4 receptors studied by molecular modelling. Structure. 1994 Sep 15;2(9):839-51. [Article]
- Wang X, Rickert M, Garcia KC: Structure of the quaternary complex of interleukin-2 with its alpha, beta, and gammac receptors. Science. 2005 Nov 18;310(5751):1159-63. [Article]
- Stauber DJ, Debler EW, Horton PA, Smith KA, Wilson IA: Crystal structure of the IL-2 signaling complex: paradigm for a heterotrimeric cytokine receptor. Proc Natl Acad Sci U S A. 2006 Feb 21;103(8):2788-93. Epub 2006 Feb 13. [Article]
- Lowe CE, Cooper JD, Brusko T, Walker NM, Smyth DJ, Bailey R, Bourget K, Plagnol V, Field S, Atkinson M, Clayton DG, Wicker LS, Todd JA: Large-scale genetic fine mapping and genotype-phenotype associations implicate polymorphism in the IL2RA region in type 1 diabetes. Nat Genet. 2007 Sep;39(9):1074-82. Epub 2007 Aug 5. [Article]
- Goudy K, Aydin D, Barzaghi F, Gambineri E, Vignoli M, Ciullini Mannurita S, Doglioni C, Ponzoni M, Cicalese MP, Assanelli A, Tommasini A, Brigida I, Dellepiane RM, Martino S, Olek S, Aiuti A, Ciceri F, Roncarolo MG, Bacchetta R: Human IL2RA null mutation mediates immunodeficiency with lymphoproliferation and autoimmunity. Clin Immunol. 2013 Mar;146(3):248-61. doi: 10.1016/j.clim.2013.01.004. Epub 2013 Jan 24. [Article]
- Bezrodnik L, Caldirola MS, Seminario AG, Moreira I, Gaillard MI: Follicular bronchiolitis as phenotype associated with CD25 deficiency. Clin Exp Immunol. 2014 Feb;175(2):227-34. doi: 10.1111/cei.12214. [Article]
Associated Data
- Bio-Entities
Bio-Entity Type Interleukin-2 receptor subunit alpha (Humans) protein primary- Drug Relations
Drug Drug group Pharmacological action? Type Actions Details Denileukin diftitox approved, investigational yes target ligand Details Basiliximab approved, investigational yes target antibody Details Daclizumab investigational, withdrawn yes target antibody Details Aldesleukin approved yes target agonistmodulator Details Inolimomab investigational unknown target antibody Details Camidanlumab tesirine investigational unknown target antibodyregulator Details