30S ribosomal protein S7
Details
- Name
- 30S ribosomal protein S7
- Synonyms
- Not Available
- Gene Name
- rpsG
- Organism
- Escherichia coli (strain K12)
- Amino acid sequence
>lcl|BSEQ0017498|30S ribosomal protein S7 MPRRRVIGQRKILPDPKFGSELLAKFVNILMVDGKKSTAESIVYSALETLAQRSGKSELE AFEVALENVRPTVEVKSRRVGGSTYQVPVEVRPVRRNALAMRWIVEAARKRGDKSMALRL ANELSDAAENKGTAVKKREDVHRMAEANKAFAHYRWLSLRSFSHQAGASSKQPALGYLN
- Number of residues
- 179
- Molecular Weight
- 20018.91
- Theoretical pI
- Not Available
- GO Classification
- FunctionsmRNA binding / rRNA binding / structural constituent of ribosome / tRNA bindingProcessesnegative regulation of translation / ribosomal small subunit assembly / translationComponentscytosol / cytosolic small ribosomal subunit / membrane
- General Function
- Trna binding
- Specific Function
- One of the primary rRNA binding proteins, it binds directly to 16S rRNA where it nucleates assembly of the head domain of the 30S subunit. Is located at the subunit interface close to the decoding center, where it has been shown to contact mRNA. Has been shown to contact tRNA in both the P and E sites; it probably blocks exit of the E site tRNA.Protein S7 is also a translational repressor protein; it regulates the expression of the str operon members to different degrees by binding to its mRNA.
- Pfam Domain Function
- Ribosomal_S7 (PF00177)
- Transmembrane Regions
- Not Available
- Cellular Location
- Not Available
- Gene sequence
>lcl|BSEQ0017499|30S ribosomal protein S7 (rpsG) ATGCCACGTCGTCGCGTCATTGGTCAGCGTAAAATTCTGCCGGATCCGAAGTTCGGATCA GAACTGCTGGCTAAATTTGTAAATATCCTGATGGTAGATGGTAAAAAATCTACTGCTGAA TCTATCGTATACAGCGCGCTGGAGACCCTGGCTCAGCGCTCTGGTAAATCTGAACTGGAA GCATTCGAAGTAGCTCTCGAAAACGTGCGCCCGACTGTAGAAGTTAAGTCTCGCCGCGTT GGTGGTTCTACTTATCAGGTACCAGTTGAAGTCCGTCCGGTTCGTCGTAATGCTCTGGCA ATGCGTTGGATCGTTGAAGCTGCTCGTAAACGCGGTGATAAATCCATGGCTCTGCGCCTG GCGAACGAACTTTCTGATGCTGCAGAAAACAAAGGTACTGCAGTTAAGAAACGTGAAGAC GTTCACCGTATGGCCGAAGCCAACAAGGCGTTCGCACACTACCGTTGGTTATCCCTTCGG AGTTTTAGTCACCAGGCGGGCGCTTCCAGTAAGCAGCCCGCTTTGGGCTACTTAAATTGA
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P02359 UniProtKB Entry Name RS7_ECOLI - General References
- Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y: The complete genome sequence of Escherichia coli K-12. Science. 1997 Sep 5;277(5331):1453-62. [Article]
- Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T: Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. Mol Syst Biol. 2006;2:2006.0007. Epub 2006 Feb 21. [Article]
- Reinbolt J, Tritsch D, Wittmann-Liebold B: The primary structure of ribosomal protein S7 from E. coli strains K and B. Biochimie. 1979;61(4):501-22. [Article]
- Post LE, Nomura M: DNA sequences from the str operon of Escherichia coli. J Biol Chem. 1980 May 25;255(10):4660-6. [Article]
- Timms AR, Steingrimsdottir H, Lehmann AR, Bridges BA: Mutant sequences in the rpsL gene of Escherichia coli B/r: mechanistic implications for spontaneous and ultraviolet light mutagenesis. Mol Gen Genet. 1992 Mar;232(1):89-96. [Article]
- Johanson U, Hughes D: Comparison of the complete sequence of the str operon in Salmonella typhimurium and Escherichia coli. Gene. 1992 Oct 12;120(1):93-8. [Article]
- Urlaub H, Kruft V, Bischof O, Muller EC, Wittmann-Liebold B: Protein-rRNA binding features and their structural and functional implications in ribosomes as determined by cross-linking studies. EMBO J. 1995 Sep 15;14(18):4578-88. [Article]
- MacKeen LA, Kahan L, Wahba AJ, Schwartz I: Photochemical cross-linking of initiation factor-3 to Escherichia coli 30 S ribosomal subunits. J Biol Chem. 1980 Nov 10;255(21):10526-31. [Article]
- Boileau G, Butler P, Hershey JW, Traut RR: Direct cross-links between initiation factors 1, 2, and 3 and ribosomal proteins promoted by 2-iminothiolane. Biochemistry. 1983 Jun 21;22(13):3162-70. [Article]
- Nowotny V, Nierhaus KH: Assembly of the 30S subunit from Escherichia coli ribosomes occurs via two assembly domains which are initiated by S4 and S7. Biochemistry. 1988 Sep 6;27(18):7051-5. [Article]
- Saito K, Mattheakis LC, Nomura M: Post-transcriptional regulation of the str operon in Escherichia coli. Ribosomal protein S7 inhibits coupled translation of S7 but not its independent translation. J Mol Biol. 1994 Jan 7;235(1):111-24. [Article]
- Osswald M, Doring T, Brimacombe R: The ribosomal neighbourhood of the central fold of tRNA: cross-links from position 47 of tRNA located at the A, P or E site. Nucleic Acids Res. 1995 Nov 25;23(22):4635-41. [Article]
- Greuer B, Thiede B, Brimacombe R: The cross-link from the upstream region of mRNA to ribosomal protein S7 is located in the C-terminal peptide: experimental verification of a prediction from modeling studies. RNA. 1999 Dec;5(12):1521-5. [Article]
- Fredrick K, Dunny GM, Noller HF: Tagging ribosomal protein S7 allows rapid identification of mutants defective in assembly and function of 30 S subunits. J Mol Biol. 2000 May 5;298(3):379-94. [Article]
- Robert F, Brakier-Gingras L: Ribosomal protein S7 from Escherichia coli uses the same determinants to bind 16S ribosomal RNA and its messenger RNA. Nucleic Acids Res. 2001 Feb 1;29(3):677-82. [Article]
- Arnold RJ, Reilly JP: Observation of Escherichia coli ribosomal proteins and their posttranslational modifications by mass spectrometry. Anal Biochem. 1999 Apr 10;269(1):105-12. [Article]
- Dallas A, Noller HF: Interaction of translation initiation factor 3 with the 30S ribosomal subunit. Mol Cell. 2001 Oct;8(4):855-64. [Article]
- Tung CS, Joseph S, Sanbonmatsu KY: All-atom homology model of the Escherichia coli 30S ribosomal subunit. Nat Struct Biol. 2002 Oct;9(10):750-5. [Article]
- Gao H, Sengupta J, Valle M, Korostelev A, Eswar N, Stagg SM, Van Roey P, Agrawal RK, Harvey SC, Sali A, Chapman MS, Frank J: Study of the structural dynamics of the E coli 70S ribosome using real-space refinement. Cell. 2003 Jun 13;113(6):789-801. [Article]
- Schuwirth BS, Borovinskaya MA, Hau CW, Zhang W, Vila-Sanjurjo A, Holton JM, Cate JH: Structures of the bacterial ribosome at 3.5 A resolution. Science. 2005 Nov 4;310(5749):827-34. [Article]
Drug Relations
- Drug Relations
DrugBank ID Name Drug group Pharmacological action? Actions Details DB00759 Tetracycline approved, vet_approved, withdrawn yes inhibitor Details DB13092 Meclocycline investigational yes antagonist Details DB09093 Chlortetracycline approved, investigational, vet_approved yes inhibitor Details DB12455 Omadacycline approved, investigational yes inhibitor Details