T-cell surface glycoprotein CD3 gamma chain

Details

Name
T-cell surface glycoprotein CD3 gamma chain
Synonyms
  • T-cell receptor T3 gamma chain
  • T3G
Gene Name
CD3G
Organism
Humans
Amino acid sequence
>lcl|BSEQ0012414|T-cell surface glycoprotein CD3 gamma chain
MEQGKGLAVLILAIILLQGTLAQSIKGNHLVKVYDYQEDGSVLLTCDAEAKNITWFKDGK
MIGFLTEDKKKWNLGSNAKDPRGMYQCKGSQNKSKPLQVYYRMCQNCIELNAATISGFLF
AEIVSIFVLAVGVYFIAGQDGVRQSRASDKQTLLPNDQLYQPLKDREDDQYSHLQGNQLR
RN
Number of residues
182
Molecular Weight
20469.335
Theoretical pI
8.59
GO Classification
Functions
protein heterodimerization activity / receptor signaling complex scaffold activity / T cell receptor binding / transmembrane signaling receptor activity
Processes
cell surface receptor signaling pathway / establishment or maintenance of cell polarity / Fc-gamma receptor signaling pathway involved in phagocytosis / innate immune response / protein complex assembly / protein transport / regulation of immune response / regulation of lymphocyte apoptotic process / T cell activation / T cell costimulation / T cell receptor signaling pathway
Components
alpha-beta T cell receptor complex / integral component of plasma membrane / plasma membrane / T cell receptor complex
General Function
Transmembrane signaling receptor activity
Specific Function
The CD3 complex mediates signal transduction.
Pfam Domain Function
Transmembrane Regions
117-137
Cellular Location
Membrane
Gene sequence
>lcl|BSEQ0012415|T-cell surface glycoprotein CD3 gamma chain (CD3G)
ATGGAACAGGGGAAGGGCCTGGCTGTCCTCATCCTGGCTATCATTCTTCTTCAAGGTACT
TTGGCCCAGTCAATCAAAGGAAACCACTTGGTTAAGGTGTATGACTATCAAGAAGATGGT
TCGGTACTTCTGACTTGTGATGCAGAAGCCAAAAATATCACATGGTTTAAAGATGGGAAG
ATGATCGGCTTCCTAACTGAAGATAAAAAAAAATGGAATCTGGGAAGTAATGCCAAGGAC
CCTCGAGGGATGTATCAGTGTAAAGGATCACAGAACAAGTCAAAACCACTCCAAGTGTAT
TACAGAATGTGTCAGAACTGCATTGAACTAAATGCAGCCACCATATCTGGCTTTCTCTTT
GCTGAAATCGTCAGCATTTTCGTCCTTGCTGTTGGGGTCTACTTCATTGCTGGACAGGAT
GGAGTTCGCCAGTCGAGAGCTTCAGACAAGCAGACTCTGTTGCCCAATGACCAGCTCTAC
CAGCCCCTCAAGGATCGAGAAGATGACCAGTACAGCCACCTTCAAGGAAACCAGTTGAGG
AGGAATTGA
Chromosome Location
11
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP09693
UniProtKB Entry NameCD3G_HUMAN
GenBank Gene IDBC113830
GenAtlas IDCD3G
HGNC IDHGNC:1675
General References
  1. Krissansen GW, Owen MJ, Verbi W, Crumpton MJ: Primary structure of the T3 gamma subunit of the T3/T cell antigen receptor complex deduced from cDNA sequences: evolution of the T3 gamma and delta subunits. EMBO J. 1986 Aug;5(8):1799-808. [Article]
  2. Tunnacliffe A, Buluwela L, Rabbitts TH: Physical linkage of three CD3 genes on human chromosome 11. EMBO J. 1987 Oct;6(10):2953-7. [Article]
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
  4. Alexander D, Goris J, Marais R, Rothbard J, Merlevede W, Crumpton MJ: Dephosphorylation of the human T lymphocyte CD3 antigen. Eur J Biochem. 1989 Apr 15;181(1):55-65. [Article]
  5. Davies AA, Cantrell DA, Hexham JM, Parker PJ, Rothbard J, Crumpton MJ: The human T3 gamma chain is phosphorylated at serine 126 in response to T lymphocyte activation. J Biol Chem. 1987 Aug 15;262(23):10918-21. [Article]
  6. Letourneur F, Klausner RD: A novel di-leucine motif and a tyrosine-based motif independently mediate lysosomal targeting and endocytosis of CD3 chains. Cell. 1992 Jun 26;69(7):1143-57. [Article]
  7. Arnaiz-Villena A, Timon M, Corell A, Perez-Aciego P, Martin-Villa JM, Regueiro JR: Brief report: primary immunodeficiency caused by mutations in the gene encoding the CD3-gamma subunit of the T-lymphocyte receptor. N Engl J Med. 1992 Aug 20;327(8):529-33. [Article]
  8. Recio MJ, Moreno-Pelayo MA, Kilic SS, Guardo AC, Sanal O, Allende LM, Perez-Flores V, Mencia A, Modamio-Hoybjor S, Seoane E, Regueiro JR: Differential biological role of CD3 chains revealed by human immunodeficiencies. J Immunol. 2007 Feb 15;178(4):2556-64. [Article]
  9. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [Article]
  10. Kjer-Nielsen L, Dunstone MA, Kostenko L, Ely LK, Beddoe T, Mifsud NA, Purcell AW, Brooks AG, McCluskey J, Rossjohn J: Crystal structure of the human T cell receptor CD3 epsilon gamma heterodimer complexed to the therapeutic mAb OKT3. Proc Natl Acad Sci U S A. 2004 May 18;101(20):7675-80. Epub 2004 May 10. [Article]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00075Muromonabapproved, investigationalyesDetails
DB16655Teclistamabapproved, investigationalyesantibodyDetails
DB16684OdronextamabinvestigationalyesbinderDetails
DB16371Glofitamabapproved, investigationalyesbinderantibodyDetails
DB15395Elranatamabapproved, investigationalunknownantibodyDetails
DB16678Talquetamabapproved, investigationalyesantibodyDetails