Soluble cytochrome b562
Details
- Name
- Soluble cytochrome b562
- Synonyms
- Cytochrome b-562
- Gene Name
- cybC
- Organism
- Escherichia coli
- Amino acid sequence
>lcl|BSEQ0003956|Soluble cytochrome b562 MRKSLLAILAVSSLVFSSASFAADLEDNMETLNDNLKVIEKADNAAQVKDALTKMRAAAL DAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTR NAYHQKYR
- Number of residues
- 128
- Molecular Weight
- 14060.815
- Theoretical pI
- 6.54
- GO Classification
- Functionselectron carrier activity / heme binding / iron ion bindingProcesseselectron transport chainComponentsperiplasmic space
- General Function
- Iron ion binding
- Specific Function
- Electron-transport protein of unknown function.
- Pfam Domain Function
- Cytochrom_B562 (PF07361)
- Transmembrane Regions
- Not Available
- Cellular Location
- Periplasm
- Gene sequence
>lcl|BSEQ0003955|387 bp ATGCGTAAAAGCCTGTTAGCTATTCTTGCAGTCTCCTCGTTGGTATTCAGTTCTGCGTCG TTTGCCGCTGATCTTGAAGACAATATGGAAACCCTCAACGACAATTTAAAAGTGATCGAA AAAGCGGATAACGCGGCGCAAGTCAAAGACGCGTTAACGAAGATGCGCGCCGCAGCCCTG GATGCGCAAAAAGCAACGCCGCCGAAGCTCGAAGATAAATCACCGGACAGCCCGGAAATG AAAGATTTCCGCCACGGTTTCGACATTCTGGTCGGTCAGATTGACGACGCGCTGAAGCTG GCAAATGAAGGTAAAGTAAAAGAAGCGCAGGCTGCTGCAGAGCAACTGAAAACGACCCGC AACGCCTATCACCAGAAGTATCGTTAA
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P0ABE7 UniProtKB Entry Name C562_ECOLX GenBank Protein ID 241593 GenBank Gene ID S74736 - General References
- Nikkila H, Gennis RB, Sligar SG: Cloning and expression of the gene encoding the soluble cytochrome b562 of Escherichia coli. Eur J Biochem. 1991 Dec 5;202(2):309-13. [Article]
- Trower MK: PCR cloning, sequence analysis and expression of the cybC genes encoding soluble cytochrome b-562 from Escherichia coli B strain OP7 and K strain NM522. Biochim Biophys Acta. 1993 Jun 10;1143(1):109-11. [Article]
- Itagaki E, Hager LP: The amino acid sequence of cytochrome b562 of Escherichia coli. Biochem Biophys Res Commun. 1968 Sep 30;32(6):1013-9. [Article]
- Mathews FS, Bethge PH, Czerwinski EW: The structure of cytochrome b562 from Escherichia coli at 2.5 A resolution. J Biol Chem. 1979 Mar 10;254(5):1699-706. [Article]
- Lederer F, Glatigny A, Bethge PH, Bellamy HD, Matthew FS: Improvement of the 2.5 A resolution model of cytochrome b562 by redetermining the primary structure and using molecular graphics. J Mol Biol. 1981 Jun 5;148(4):427-48. [Article]
- Hamada K, Bethge PH, Mathews FS: Refined structure of cytochrome b562 from Escherichia coli at 1.4 A resolution. J Mol Biol. 1995 Apr 14;247(5):947-62. [Article]
- Springs SL, Bass SE, Bowman G, Nodelman I, Schutt CE, McLendon GL: A multigeneration analysis of cytochrome b(562) redox variants: evolutionary strategies for modulating redox potential revealed using a library approach. Biochemistry. 2002 Apr 2;41(13):4321-8. [Article]
- Arnesano F, Banci L, Bertini I, Faraone-Mennella J, Rosato A, Barker PD, Fersht AR: The solution structure of oxidized Escherichia coli cytochrome b562. Biochemistry. 1999 Jul 6;38(27):8657-70. [Article]
- Assfalg M, Banci L, Bertini I, Ciofi-Baffoni S, Barker PD: (15)N backbone dynamics of ferricytochrome b(562): comparison with the reduced protein and the R98C variant. Biochemistry. 2001 Oct 30;40(43):12761-71. [Article]