Muscarinic acetylcholine receptor M1
Details
- Name
- Muscarinic acetylcholine receptor M1
- Synonyms
- Not Available
- Gene Name
- CHRM1
- UniProtKB Entry
- P11229Swiss-Prot
- Organism
- Humans
- NCBI Taxonomy ID
- 9606
- Amino acid sequence
>lcl|BSEQ0000184|Muscarinic acetylcholine receptor M1 MNTSAPPAVSPNITVLAPGKGPWQVAFIGITTGLLSLATVTGNLLVLISFKVNTELKTVN NYFLLSLACADLIIGTFSMNLYTTYLLMGHWALGTLACDLWLALDYVASNASVMNLLLIS FDRYFSVTRPLSYRAKRTPRRAALMIGLAWLVSFVLWAPAILFWQYLVGERTVLAGQCYI QFLSQPIITFGTAMAAFYLPVTVMCTLYWRIYRETENRARELAALQGSETPGKGGGSSSS SERSQPGAEGSPETPPGRCCRCCRAPRLLQAYSWKEEEEEDEGSMESLTSSEGEEPGSEV VIKMPMVDPEAQAPTKQPPRSSPNTVKRPTKKGRDRAGKGQKPRGKEQLAKRKTFSLVKE KKAARTLSAILLAFILTWTPYNIMVLVSTFCKDCVPETLWELGYWLCYVNSTINPMCYAL CNKAFRDTFRLLLLCRWDKRRWRKIPKRPGSVHRTPSRQC
- Number of residues
- 460
- Molecular Weight
- 51420.375
- Theoretical pI
- 9.67
- GO Classification
- FunctionsG protein-coupled acetylcholine receptor activity / G protein-coupled serotonin receptor activityProcessesadenylate cyclase-inhibiting G protein-coupled acetylcholine receptor signaling pathway / chemical synaptic transmission / G protein-coupled acetylcholine receptor signaling pathway / G protein-coupled receptor signaling pathway / G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger / phospholipase C-activating G protein-coupled acetylcholine receptor signaling pathway / positive regulation of monoatomic ion transport / postsynaptic modulation of chemical synaptic transmission / protein kinase C-activating G protein-coupled receptor signaling pathway / regulation of glial cell proliferation / regulation of postsynaptic membrane potentialComponentscholinergic synapse / glutamatergic synapse / postsynaptic density membrane / presynaptic membrane / Schaffer collateral - CA1 synapse
- General Function
- The muscarinic acetylcholine receptor mediates various cellular responses, including inhibition of adenylate cyclase, breakdown of phosphoinositides and modulation of potassium channels through the action of G proteins. Primary transducing effect is Pi turnover
- Specific Function
- G protein-coupled acetylcholine receptor activity
- Pfam Domain Function
- 7tm_1 (PF00001)
- Signal Regions
- Not Available
- Transmembrane Regions
- 23-48 63-84 96-121 143-164 186-209 367-390 398-420
- Cellular Location
- Cell membrane
- Gene sequence
>lcl|BSEQ0009929|Muscarinic acetylcholine receptor M1 (CHRM1) ATGAACACTTCAGCCCCACCTGCTGTCAGCCCCAACATCACCGTCCTGGCACCAGGAAAG GGTCCCTGGCAAGTGGCCTTCATTGGGATCACCACGGGCCTCCTGTCGCTAGCCACAGTG ACAGGCAACCTGCTGGTACTCATCTCTTTCAAGGTCAACACGGAGCTCAAGACAGTCAAT AACTACTTCCTGCTGAGCCTGGCCTGTGCTGACCTCATCATCGGTACCTTCTCCATGAAC CTCTATACCACGTACCTGCTCATGGGCCACTGGGCTCTGGGCACGCTGGCTTGTGACCTC TGGCTGGCCCTGGACTATGTGGCCAGCAATGCCTCCGTCATGAATCTGCTGCTCATCAGC TTTGACCGCTACTTCTCCGTGACTCGGCCCCTGAGCTACCGTGCCAAGCGCACACCCCGC CGGGCAGCTCTGATGATCGGCCTGGCCTGGCTGGTTTCCTTTGTGCTCTGGGCCCCAGCC ATCCTCTTCTGGCAGTACCTGGTAGGGGAGCGGACAGTGCTAGCTGGGCAGTGCTACATC CAGTTCCTCTCCCAGCCCATCATCACCTTTGGCACAGCCATGGCTGCCTTCTACCTCCCT GTCACAGTCATGTGCACGCTCTACTGGCGCATCTACCGGGAGACAGAGAACCGAGCACGG GAGCTGGCAGCCCTTCAGGGCTCCGAGACGCCAGGCAAAGGGGGTGGCAGCAGCAGCAGC TCAGAGAGGTCTCAGCCAGGGGCTGAGGGCTCACCAGAGACTCCTCCAGGCCGCTGCTGT CGCTGCTGCCGGGCCCCCAGGCTGCTGCAGGCCTACAGCTGGAAGGAAGAAGAGGAAGAG GACGAAGGCTCCATGGAGTCCCTCACATCCTCAGAGGGAGAGGAGCCTGGCTCCGAAGTG GTGATCAAGATGCCAATGGTGGACCCCGAGGCACAGGCCCCCACCAAGCAGCCCCCACGG AGCTCCCCAAATACAGTCAAGAGGCCGACTAAGAAAGGGCGTGATCGAGCTGGCAAGGGC CAGAAGCCCCGTGGAAAGGAGCAGCTGGCCAAGCGGAAGACCTTCTCGCTGGTCAAGGAG AAGAAGGCGGCTCGGACCCTGAGTGCCATCCTCCTGGCCTTCATCCTCACCTGGACACCG TACAACATCATGGTGCTGGTGTCCACCTTCTGCAAGGACTGTGTTCCCGAGACCCTGTGG GAGCTGGGCTACTGGCTGTGCTACGTCAACAGCACCATCAACCCCATGTGCTACGCACTC TGCAACAAAGCCTTCCGGGACACCTTTCGCCTGCTGCTGCTTTGCCGCTGGGACAAGAGA CGCTGGCGCAAGATCCCCAAGCGCCCTGGCTCCGTGCACCGCACTCCCTCCCGCCAATGC TGA
- Chromosome Location
- 11
- Locus
- 11q12.3
- External Identifiers
Resource Link UniProtKB ID P11229 UniProtKB Entry Name ACM1_HUMAN GenBank Protein ID 34451 GenBank Gene ID X52068 GeneCard ID CHRM1 GenAtlas ID CHRM1 HGNC ID HGNC:1950 PDB ID(s) 5CXV, 6OIJ, 6WJC, 6ZFZ, 6ZG4, 6ZG9 KEGG ID hsa:1128 IUPHAR/Guide To Pharmacology ID 13 NCBI Gene ID 1128 - General References
- Allard WJ, Sigal IS, Dixon RA: Sequence of the gene encoding the human M1 muscarinic acetylcholine receptor. Nucleic Acids Res. 1987 Dec 23;15(24):10604. [Article]
- Chapman CG, Browne MJ: Isolation of the human ml (Hml) muscarinic acetylcholine receptor gene by PCR amplification. Nucleic Acids Res. 1990 Apr 25;18(8):2191. [Article]
- Peralta EG, Ashkenazi A, Winslow JW, Smith DH, Ramachandran J, Capon DJ: Distinct primary structures, ligand-binding properties and tissue-specific expression of four human muscarinic acetylcholine receptors. EMBO J. 1987 Dec 20;6(13):3923-9. [Article]
- Taylor TD, Noguchi H, Totoki Y, Toyoda A, Kuroki Y, Dewar K, Lloyd C, Itoh T, Takeda T, Kim DW, She X, Barlow KF, Bloom T, Bruford E, Chang JL, Cuomo CA, Eichler E, FitzGerald MG, Jaffe DB, LaButti K, Nicol R, Park HS, Seaman C, Sougnez C, Yang X, Zimmer AR, Zody MC, Birren BW, Nusbaum C, Fujiyama A, Hattori M, Rogers J, Lander ES, Sakaki Y: Human chromosome 11 DNA sequence and analysis including novel gene identification. Nature. 2006 Mar 23;440(7083):497-500. [Article]
- Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
- Arden JR, Nagata O, Shockley MS, Philip M, Lameh J, Sadee W: Mutational analysis of third cytoplasmic loop domains in G-protein coupling of the HM1 muscarinic receptor. Biochem Biophys Res Commun. 1992 Nov 16;188(3):1111-5. [Article]
- Simonin F, Karcher P, Boeuf JJ, Matifas A, Kieffer BL: Identification of a novel family of G protein-coupled receptor associated sorting proteins. J Neurochem. 2004 May;89(3):766-75. [Article]
Associated Data
- Bio-Entities
Bio-Entity Type Muscarinic acetylcholine receptor M1 (Humans) protein primaryMuscarinic acetylcholine receptor (Humans) protein - Drug Relations
Drug Drug group Pharmacological action? Type Actions Details Cevimeline approved yes target agonist Details Trospium approved unknown target antagonist Details Oxyphenonium approved yes target antagonist Details Benzatropine approved yes target antagonist Details Ipratropium approved, experimental yes target antagonist Details Trihexyphenidyl approved yes target antagonist Details Oxyphencyclimine approved yes target antagonist Details Procyclidine approved yes target antagonist Details Carbamoylcholine approved yes target agonist Details Hyoscyamine approved yes target antagonist Details Methscopolamine bromide approved yes target antagonist Details Tridihexethyl withdrawn yes target antagonist Details Anisotropine methylbromide approved yes target antagonist Details Pirenzepine approved yes target antagonist Details Scopolamine approved, investigational yes target antagonist Details Clidinium approved yes target antagonist Details Propantheline approved yes target antagonist Details Dicyclomine approved yes target antagonist Details Methantheline approved, investigational unknown target antagonist Details Cycrimine approved yes target antagonist Details Cyclopentolate approved yes target antagonist Details Glycopyrronium approved, investigational, vet_approved yes target antagonist Details Tolterodine approved, investigational yes target antagonist Details Oxybutynin approved, investigational yes target antagonist Details Pilocarpine approved, investigational yes target agonist Details Flavoxate approved yes target antagonist Details Desipramine approved, investigational no target antagonist Details Metoclopramide approved, investigational yes target agonist Details Olanzapine approved, investigational unknown target antagonist Details Buclizine approved yes target antagonist Details Profenamine approved yes target antagonist Details Promazine approved, vet_approved unknown target antagonist Details Triflupromazine approved, vet_approved yes target antagonist Details Atropine approved, vet_approved yes target antagonist Details Homatropine methylbromide approved yes target antagonist Details Benzquinamide withdrawn yes target antagonist Details Biperiden approved, investigational yes target antagonist Details Promethazine approved, investigational unknown target antagonist Details Diphenidol approved, investigational, withdrawn yes target antagonist Details Methotrimeprazine approved, investigational unknown target antagonist Details Arecoline experimental yes target inhibitor Details Solifenacin approved unknown target antagonist Details NGX267 investigational yes target agonist Details ALKS 27 investigational unknown target Details Norclozapine investigational yes target modulator Details Nicardipine approved, investigational unknown target antagonist Details Fesoterodine approved unknown target antagonist Details Quetiapine approved unknown target antagonist Details Tiotropium approved unknown target antagonist Details Ziprasidone approved unknown target antagonist Details Clozapine approved unknown target partial agonist Details Darifenacin approved, investigational unknown target antagonist Details Molindone approved unknown target other/unknown Details Cocaine approved, illicit unknown target antagonist Details Disopyramide approved unknown target antagonist Details Chlorprothixene approved, experimental, investigational, withdrawn no target antagonist Details Doxepin approved, investigational unknown target antagonist Details Imipramine approved no target antagonist Details Cyproheptadine approved unknown target antagonist Details Amoxapine approved unknown target antagonist Details Escitalopram approved unknown target inhibitor Details Brompheniramine approved unknown target antagonist Details Tropicamide approved, investigational yes target antagonist Details Maprotiline approved, investigational no target antagonist Details Flupentixol approved, investigational, withdrawn unknown target antagonist Details Minaprine approved unknown target agonist Details Mepenzolate approved yes target antagonist Details Aclidinium approved yes target antagonist Details Chlorpromazine approved, investigational, vet_approved unknown target antagonist Details Loxapine approved unknown target binder Details Terfenadine approved, withdrawn unknown target binder Details Umeclidinium approved unknown target antagonist Details Hexocyclium approved unknown target antagonist Details Dosulepin approved yes target antagonist Details Imidafenacin investigational yes target antagonist Details Acetylcholine approved, investigational unknown target Details Gallamine triethiodide approved unknown target Details Staurosporine experimental unknown target Details Bethanechol approved unknown target agonist Details Pyrantel approved, vet_approved no target antagonistagonist Details Homatropine approved yes target antagonist Details Pizotifen approved unknown target antagonist Details Propiverine approved, investigational yes target antagonist Details Thonzylamine approved unknown target antagonist Details Tramadol approved, investigational unknown target antagonist Details Rociverine experimental yes target antagonist Details Trimebutine approved yes target antagonist Details Aripiprazole lauroxil approved, investigational no target Details Aripiprazole approved, investigational unknown target ligand Details Methacholine approved, investigational unknown target agonist Details Viloxazine approved, investigational, withdrawn unknown target antagonist Details Brexpiprazole approved, investigational unknown target antagonist Details Blarcamesine investigational yes target agonist Details Caramiphen experimental, vet_approved yes target inhibitor Details Declopramide investigational yes target modulator Details Sobetirome investigational yes target agonist Details TAK-071 investigational yes target modulator Details Aceclidine approved yes target inhibitor Details Metixene approved yes target modulator Details Diphemanil approved, vet_approved, withdrawn yes target modulator Details AF-710B investigational yes target agonist Details Metixene approved yes target antagonist Details Doxylamine approved, vet_approved unknown target antagonist Details Propiomazine approved unknown target antagonist Details Amoxapine approved unknown target antagonist Details Trimipramine approved unknown target binder Details Meperidine approved unknown target binder Details Cinnarizine approved, investigational unknown target binder Details Ketamine approved, vet_approved unknown target binder Details Etoperidone withdrawn unknown target antagonist Details Revefenacin approved, investigational yes target antagonist Details Amitriptyline approved unknown target ligand Details Paroxetine approved, investigational unknown target inhibitor Details Nortriptyline approved unknown target antagonist Details Sofpironium approved, investigational yes target inhibitor Details