Interferon gamma receptor 1

Details

Name
Interferon gamma receptor 1
Synonyms
  • CDw119
  • IFN-gamma receptor 1
Gene Name
IFNGR1
Organism
Humans
Amino acid sequence
>lcl|BSEQ0001418|Interferon gamma receptor 1
MALLFLLPLVMQGVSRAEMGTADLGPSSVPTPTNVTIESYNMNPIVYWEYQIMPQVPVFT
VEVKNYGVKNSEWIDACINISHHYCNISDHVGDPSNSLWVRVKARVGQKESAYAKSEEFA
VCRDGKIGPPKLDIRKEEKQIMIDIFHPSVFVNGDEQEVDYDPETTCYIRVYNVYVRMNG
SEIQYKILTQKEDDCDEIQCQLAIPVSSLNSQYCVSAEGVLHVWGVTTEKSKEVCITIFN
SSIKGSLWIPVVAALLLFLVLSLVFICFYIKKINPLKEKSIILPKSLISVVRSATLETKP
ESKYVSLITSYQPFSLEKEVVCEEPLSPATVPGMHTEDNPGKVEHTEELSSITEVVTTEE
NIPDVVPGSHLTPIERESSSPLSSNQSEPGSIALNSYHSRNCSESDHSRNGFDTDSSCLE
SHSSLSDSEFPPNNKGEIKTEGQELITVIKAPTSFGYDKPHVLVDLLVDDSGKESLIGYR
PTEDSKEFS
Number of residues
489
Molecular Weight
54404.07
Theoretical pI
4.56
GO Classification
Functions
interferon-gamma receptor activity
Processes
cytokine-mediated signaling pathway / interferon-gamma-mediated signaling pathway / regulation of interferon-gamma-mediated signaling pathway / response to virus / signal transduction
Components
integral component of plasma membrane / plasma membrane
General Function
Interferon-gamma receptor activity
Specific Function
Receptor for interferon gamma. Two receptors bind one interferon gamma dimer.
Pfam Domain Function
Transmembrane Regions
246-266
Cellular Location
Membrane
Gene sequence
>lcl|BSEQ0010499|Interferon gamma receptor 1 (IFNGR1)
ATGGCTCTCCTCTTTCTCCTACCCCTTGTCATGCAGGGTGTGAGCAGGGCTGAGATGGGC
ACCGCGGATCTGGGGCCGTCCTCAGTGCCTACACCAACTAATGTTACAATTGAATCCTAT
AACATGAACCCTATCGTATATTGGGAGTACCAGATCATGCCACAGGTCCCTGTTTTTACC
GTAGAGGTAAAGAACTATGGTGTTAAGAATTCAGAATGGATTGATGCCTGCATCAATATT
TCTCATCATTATTGTAATATTTCTGATCATGTTGGTGATCCATCAAATTCTCTTTGGGTC
AGAGTTAAAGCCAGGGTTGGACAAAAAGAATCTGCCTATGCAAAGTCAGAAGAATTTGCT
GTATGCCGAGATGGAAAAATTGGACCACCTAAACTGGATATCAGAAAGGAGGAGAAGCAA
ATCATGATTGACATATTTCACCCTTCAGTTTTTGTAAATGGAGACGAGCAGGAAGTCGAT
TATGATCCCGAAACTACCTGTTACATTAGGGTGTACAATGTGTATGTGAGAATGAACGGA
AGTGAGATCCAGTATAAAATACTCACGCAGAAGGAAGATGATTGTGACGAGATTCAGTGC
CAGTTAGCGATTCCAGTATCCTCACTGAATTCTCAGTACTGTGTTTCAGCAGAAGGAGTC
TTACATGTGTGGGGTGTTACAACTGAAAAGTCAAAAGAAGTTTGTATTACCATTTTCAAT
AGCAGTATAAAAGGTTCTCTTTGGATTCCAGTTGTTGCTGCTTTACTACTCTTTCTAGTG
CTTAGCCTGGTATTCATCTGTTTTTATATTAAGAAAATTAATCCATTGAAGGAAAAAAGC
ATAATATTACCCAAGTCCTTGATCTCTGTGGTAAGAAGTGCTACTTTAGAGACAAAACCT
GAATCAAAATATGTATCACTCATCACGTCATACCAGCCATTTTCCTTAGAAAAGGAGGTG
GTCTGTGAAGAGCCGTTGTCTCCAGCAACAGTTCCAGGCATGCATACCGAAGACAATCCA
GGAAAAGTGGAACATACAGAAGAACTTTCTAGTATAACAGAAGTGGTGACTACTGAAGAA
AATATTCCTGACGTGGTCCCGGGCAGCCATCTGACTCCAATAGAGAGAGAGAGTTCTTCA
CCTTTAAGTAGTAACCAGTCTGAACCTGGCAGCATCGCTTTAAACTCGTATCACTCCAGA
AATTGTTCTGAGAGTGATCACTCCAGAAATGGTTTTGATACTGATTCCAGCTGTCTGGAA
TCACATAGCTCCTTATCTGACTCAGAATTTCCCCCAAATAATAAAGGTGAAATAAAAACA
GAAGGACAAGAGCTCATAACCGTAATAAAAGCCCCCACCTCCTTTGGTTATGATAAACCA
CATGTGCTAGTGGATCTACTTGTGGATGATAGCGGTAAAGAGTCCTTGATTGGTTATAGA
CCAACAGAAGATTCCAAAGAATTTTCATGA
Chromosome Location
6
Locus
6q23-q24
External Identifiers
ResourceLink
UniProtKB IDP15260
UniProtKB Entry NameINGR1_HUMAN
GenBank Protein ID306915
GenBank Gene IDJ03143
GenAtlas IDIFNGR1
HGNC IDHGNC:5439
General References
  1. Aguet M, Dembic Z, Merlin G: Molecular cloning and expression of the human interferon-gamma receptor. Cell. 1988 Oct 21;55(2):273-80. [PubMed:2971451]
  2. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039]
  3. Mungall AJ, Palmer SA, Sims SK, Edwards CA, Ashurst JL, Wilming L, Jones MC, Horton R, Hunt SE, Scott CE, Gilbert JG, Clamp ME, Bethel G, Milne S, Ainscough R, Almeida JP, Ambrose KD, Andrews TD, Ashwell RI, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beare DM, Beasley H, Beasley O, Bird CP, Blakey S, Bray-Allen S, Brook J, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Clark SY, Clark G, Clee CM, Clegg S, Cobley V, Collier RE, Collins JE, Colman LK, Corby NR, Coville GJ, Culley KM, Dhami P, Davies J, Dunn M, Earthrowl ME, Ellington AE, Evans KA, Faulkner L, Francis MD, Frankish A, Frankland J, French L, Garner P, Garnett J, Ghori MJ, Gilby LM, Gillson CJ, Glithero RJ, Grafham DV, Grant M, Gribble S, Griffiths C, Griffiths M, Hall R, Halls KS, Hammond S, Harley JL, Hart EA, Heath PD, Heathcott R, Holmes SJ, Howden PJ, Howe KL, Howell GR, Huckle E, Humphray SJ, Humphries MD, Hunt AR, Johnson CM, Joy AA, Kay M, Keenan SJ, Kimberley AM, King A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd CR, Lloyd DM, Loveland JE, Lovell J, Martin S, Mashreghi-Mohammadi M, Maslen GL, Matthews L, McCann OT, McLaren SJ, McLay K, McMurray A, Moore MJ, Mullikin JC, Niblett D, Nickerson T, Novik KL, Oliver K, Overton-Larty EK, Parker A, Patel R, Pearce AV, Peck AI, Phillimore B, Phillips S, Plumb RW, Porter KM, Ramsey Y, Ranby SA, Rice CM, Ross MT, Searle SM, Sehra HK, Sheridan E, Skuce CD, Smith S, Smith M, Spraggon L, Squares SL, Steward CA, Sycamore N, Tamlyn-Hall G, Tester J, Theaker AJ, Thomas DW, Thorpe A, Tracey A, Tromans A, Tubby B, Wall M, Wallis JM, West AP, White SS, Whitehead SL, Whittaker H, Wild A, Willey DJ, Wilmer TE, Wood JM, Wray PW, Wyatt JC, Young L, Younger RM, Bentley DR, Coulson A, Durbin R, Hubbard T, Sulston JE, Dunham I, Rogers J, Beck S: The DNA sequence and analysis of human chromosome 6. Nature. 2003 Oct 23;425(6960):805-11. [PubMed:14574404]
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  5. Stuber D, Friedlein A, Fountoulakis M, Lahm HW, Garotta G: Alignment of disulfide bonds of the extracellular domain of the interferon gamma receptor and investigation of their role in biological activity. Biochemistry. 1993 Mar 9;32(9):2423-30. [PubMed:8443182]
  6. Jouanguy E, Lamhamedi-Cherradi S, Lammas D, Dorman SE, Fondaneche MC, Dupuis S, Doffinger R, Altare F, Girdlestone J, Emile JF, Ducoulombier H, Edgar D, Clarke J, Oxelius VA, Brai M, Novelli V, Heyne K, Fischer A, Holland SM, Kumararatne DS, Schreiber RD, Casanova JL: A human IFNGR1 small deletion hotspot associated with dominant susceptibility to mycobacterial infection. Nat Genet. 1999 Apr;21(4):370-8. [PubMed:10192386]
  7. Walter MR, Windsor WT, Nagabhushan TL, Lundell DJ, Lunn CA, Zauodny PJ, Narula SK: Crystal structure of a complex between interferon-gamma and its soluble high-affinity receptor. Nature. 1995 Jul 20;376(6537):230-5. [PubMed:7617032]
  8. Sogabe S, Stuart F, Henke C, Bridges A, Williams G, Birch A, Winkler FK, Robinson JA: Neutralizing epitopes on the extracellular interferon gamma receptor (IFNgammaR) alpha-chain characterized by homolog scanning mutagenesis and X-ray crystal structure of the A6 fab-IFNgammaR1-108 complex. J Mol Biol. 1997 Nov 7;273(4):882-97. [PubMed:9367779]
  9. Thiel DJ, le Du MH, Walter RL, D'Arcy A, Chene C, Fountoulakis M, Garotta G, Winkler FK, Ealick SE: Observation of an unexpected third receptor molecule in the crystal structure of human interferon-gamma receptor complex. Structure. 2000 Sep 15;8(9):927-36. [PubMed:10986460]
  10. Jouanguy E, Lamhamedi-Cherradi S, Altare F, Fondaneche MC, Tuerlinckx D, Blanche S, Emile JF, Gaillard JL, Schreiber R, Levin M, Fischer A, Hivroz C, Casanova JL: Partial interferon-gamma receptor 1 deficiency in a child with tuberculoid bacillus Calmette-Guerin infection and a sibling with clinical tuberculosis. J Clin Invest. 1997 Dec 1;100(11):2658-64. [PubMed:9389728]
  11. Jouanguy E, Dupuis S, Pallier A, Doffinger R, Fondaneche MC, Fieschi C, Lamhamedi-Cherradi S, Altare F, Emile JF, Lutz P, Bordigoni P, Cokugras H, Akcakaya N, Landman-Parker J, Donnadieu J, Camcioglu Y, Casanova JL: In a novel form of IFN-gamma receptor 1 deficiency, cell surface receptors fail to bind IFN-gamma. J Clin Invest. 2000 May;105(10):1429-36. [PubMed:10811850]
  12. Thye T, Burchard GD, Nilius M, Muller-Myhsok B, Horstmann RD: Genomewide linkage analysis identifies polymorphism in the human interferon-gamma receptor affecting Helicobacter pylori infection. Am J Hum Genet. 2003 Feb;72(2):448-53. Epub 2003 Jan 6. [PubMed:12516030]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00033Interferon gamma-1bapproved, investigationalyesbinderDetails