Potassium voltage-gated channel subfamily A member 5

Details

Name
Potassium voltage-gated channel subfamily A member 5
Synonyms
  • HPCN1
  • Voltage-gated potassium channel HK2
  • Voltage-gated potassium channel subunit Kv1.5
Gene Name
KCNA5
Organism
Humans
Amino acid sequence
>lcl|BSEQ0008568|Potassium voltage-gated channel subfamily A member 5
MEIALVPLENGGAMTVRGGDEARAGCGQATGGELQCPPTAGLSDGPKEPAPKGRGAQRDA
DSGVRPLPPLPDPGVRPLPPLPEELPRPRRPPPEDEEEEGDPGLGTVEDQALGTASLHHQ
RVHINISGLRFETQLGTLAQFPNTLLGDPAKRLRYFDPLRNEYFFDRNRPSFDGILYYYQ
SGGRLRRPVNVSLDVFADEIRFYQLGDEAMERFREDEGFIKEEEKPLPRNEFQRQVWLIF
EYPESSGSARAIAIVSVLVILISIITFCLETLPEFRDERELLRHPPAPHQPPAPAPGANG
SGVMAPPSGPTVAPLLPRTLADPFFIVETTCVIWFTFELLVRFFACPSKAGFSRNIMNII
DVVAIFPYFITLGTELAEQQPGGGGGGQNGQQAMSLAILRVIRLVRVFRIFKLSRHSKGL
QILGKTLQASMRELGLLIFFLFIGVILFSSAVYFAEADNQGTHFSSIPDAFWWAVVTMTT
VGYGDMRPITVGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETDHEEPAVLKEEQG
TQSQGPGLDRGVQRKVSGSRGSFCKAGGTLENADSARRGSCPLEKCNVKAKSNVDLRRSL
YALCLDTSRETDL
Number of residues
613
Molecular Weight
67227.15
Theoretical pI
Not Available
GO Classification
Functions
alpha-actinin binding / delayed rectifier potassium channel activity / outward rectifier potassium channel activity / potassium channel inhibitor activity / protein kinase binding / scaffold protein binding / voltage-gated potassium channel activity involved in atrial cardiac muscle cell action potential repolarization / voltage-gated potassium channel activity involved in bundle of His cell action potential repolarization / voltage-gated potassium channel activity involved in SA node cell action potential repolarization
Processes
atrial cardiac muscle cell action potential / membrane hyperpolarization / membrane repolarization during bundle of His cell action potential / membrane repolarization during SA node cell action potential / negative regulation of cytosolic calcium ion concentration / negative regulation of potassium ion transport / Notch signaling pathway / positive regulation of G1/S transition of mitotic cell cycle / positive regulation of myoblast proliferation / potassium ion export / potassium ion homeostasis / potassium ion transmembrane transport / potassium ion transport / protein homooligomerization / regulation of atrial cardiac muscle cell membrane repolarization / regulation of heart rate by cardiac conduction / regulation of insulin secretion / regulation of membrane potential / regulation of potassium ion transport / regulation of vasoconstriction / response to hydrogen peroxide / response to hyperoxia / response to hypoxia / response to mechanical stimulus / response to organic substance / synaptic transmission
Components
cytosol / endoplasmic reticulum / Golgi apparatus / integral component of plasma membrane / intercalated disc / intracellular canaliculus / membrane raft / perinuclear region of cytoplasm / plasma membrane / potassium channel complex / voltage-gated potassium channel complex / Z disc
General Function
Voltage-gated potassium channel activity involved in sa node cell action potential repolarization
Specific Function
Voltage-gated potassium channel that mediates transmembrane potassium transport in excitable membranes. Forms tetrameric potassium-selective channels through which potassium ions pass in accordance with their electrochemical gradient. The channel alternates between opened and closed conformations in response to the voltage difference across the membrane. Can form functional homotetrameric channels and heterotetrameric channels that contain variable proportions of KCNA1, KCNA2, KCNA4, KCNA5, and possibly other family members as well; channel properties depend on the type of alpha subunits that are part of the channel (PubMed:12130714). Channel properties are modulated by cytoplasmic beta subunits that regulate the subcellular location of the alpha subunits and promote rapid inactivation (PubMed:12130714). Homotetrameric channels display rapid activation and slow inactivation (PubMed:8505626, PubMed:12130714). May play a role in regulating the secretion of insulin in normal pancreatic islets. Isoform 2 exhibits a voltage-dependent recovery from inactivation and an excessive cumulative inactivation (PubMed:11524461).
Pfam Domain Function
Transmembrane Regions
248-269 324-345 357-377 396-416 432-453 495-523
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0017518|Potassium voltage-gated channel subfamily A member 5 (KCNA5)
ATGGAGATCGCCCTGGTGCCCCTGGAGAACGGCGGTGCCATGACCGTCAGAGGAGGCGAT
GAGGCCCGGGCAGGCTGCGGCCAGGCCACAGGGGGAGAGCTCCAGTGTCCCCCGACGGCT
GGGCTCAGCGATGGGCCCAAGGAGCCGGCGCCAAAGGGGCGCGGCGCGCAGAGAGACGCG
GACTCGGGAGTGCGGCCCTTGCCTCCGCTGCCGGACCCGGGAGTGCGGCCCTTGCCTCCG
CTGCCAGAGGAGCTGCCACGGCCTCGACGGCCGCCTCCCGAGGACGAGGAGGAAGAAGGC
GATCCCGGCCTGGGCACGGTGGAGGACCAGGCTCTGGGCACGGCGTCCCTGCACCACCAG
CGCGTCCACATCAACATCTCCGGGCTGCGCTTTGAGACGCAGCTGGGCACCCTGGCGCAG
TTCCCCAACACACTCCTGGGGGACCCCGCCAAGCGCCTGCGCTACTTCGACCCCCTGAGG
AACGAGTACTTCTTCGACCGCAACCGGCCCAGCTTCGACGGTATCCTCTACTACTACCAG
TCCGGGGGCCGCCTGCGGAGGCCGGTCAACGTCTCCCTGGACGTGTTCGCGGACGAGATA
CGCTTCTACCAGCTGGGGGACGAGGCCATGGAGCGCTTCCGCGAGGATGAGGGCTTCATT
AAAGAAGAGGAGAAGCCCCTGCCCCGCAACGAGTTCCAGCGCCAGGTGTGGCTTATCTTC
GAGTATCCGGAGAGCTCTGGGTCCGCGCGGGCCATCGCCATCGTCTCGGTCTTGGTTATC
CTCATCTCCATCATCACCTTCTGCTTGGAGACCCTGCCTGAGTTCAGGGATGAACGTGAG
CTGCTCCGCCACCCTCCGGCGCCCCACCAGCCTCCCGCGCCCGCCCCTGGGGCCAACGGC
AGCGGGGTCATGGCCCCGCCCTCTGGCCCTACGGTGGCACCGCTCCTGCCCAGGACCCTG
GCCGACCCCTTCTTCATCGTGGAGACCACGTGCGTCATCTGGTTCACCTTCGAGCTGCTC
GTGCGCTTCTTCGCCTGCCCCAGCAAGGCAGGGTTCTCCCGGAACATCATGAACATCATC
GATGTGGTGGCCATCTTCCCCTACTTCATCACCCTGGGCACCGAACTGGCAGAGCAGCAG
CCAGGGGGTGGAGGAGGCGGCCAGAATGGGCAGCAGGCCATGTCCCTGGCCATCCTCCGA
GTCATCCGCCTGGTCCGGGTGTTCCGCATCTTCAAGCTCTCCCGCCACTCCAAGGGGCTG
CAGATCCTGGGCAAGACCTTGCAGGCCTCCATGAGGGAGCTGGGGCTGCTCATCTTCTTC
CTCTTCATCGGGGTCATCCTCTTCTCCAGTGCCGTCTACTTCGCAGAGGCTGACAACCAG
GGAACCCATTTCTCTAGCATCCCTGACGCCTTCTGGTGGGCAGTGGTCACCATGACCACT
GTGGGCTACGGGGACATGAGGCCCATCACTGTTGGGGGCAAGATCGTGGGCTCGCTGTGT
GCCATCGCCGGGGTCCTCACCATTGCCCTGCCTGTGCCCGTCATCGTCTCCAACTTCAAC
TACTTCTACCACCGGGAAACGGATCACGAGGAGCCGGCAGTCCTTAAGGAAGAGCAGGGC
ACTCAGAGCCAGGGGCCGGGGCTGGACAGAGGAGTCCAGCGGAAGGTCAGCGGGAGCAGG
GGATCCTTCTGCAAGGCTGGGGGGACCCTGGAGAATGCAGACAGTGCCCGAAGGGGCAGC
TGCCCCCTAGAGAAGTGTAACGTCAAGGCCAAGAGCAACGTGGACTTGCGGAGGTCCCTT
TATGCCCTCTGCCTGGACACCAGCCGGGAAACAGATTTGTGA
Chromosome Location
12
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP22460
UniProtKB Entry NameKCNA5_HUMAN
HGNC IDHGNC:6224
General References
  1. Tamkun MM, Knoth KM, Walbridge JA, Kroemer H, Roden DM, Glover DM: Molecular cloning and characterization of two voltage-gated K+ channel cDNAs from human ventricle. FASEB J. 1991 Mar 1;5(3):331-7. [PubMed:2001794]
  2. Philipson LH, Hice RE, Schaefer K, LaMendola J, Bell GI, Nelson DJ, Steiner DF: Sequence and functional expression in Xenopus oocytes of a human insulinoma and islet potassium channel. Proc Natl Acad Sci U S A. 1991 Jan 1;88(1):53-7. [PubMed:1986382]
  3. Curran ME, Landes GM, Keating MT: Molecular cloning, characterization, and genomic localization of a human potassium channel gene. Genomics. 1992 Apr;12(4):729-37. [PubMed:1349297]
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  5. Snyders DJ, Tamkun MM, Bennett PB: A rapidly activating and slowly inactivating potassium channel cloned from human heart. Functional analysis after stable mammalian cell culture expression. J Gen Physiol. 1993 Apr;101(4):513-43. [PubMed:8505626]
  6. Kurata HT, Soon GS, Fedida D: Altered state dependence of c-type inactivation in the long and short forms of human Kv1.5. J Gen Physiol. 2001 Sep;118(3):315-32. [PubMed:11524461]
  7. Williams CP, Hu N, Shen W, Mashburn AB, Murray KT: Modulation of the human Kv1.5 channel by protein kinase C activation: role of the Kvbeta1.2 subunit. J Pharmacol Exp Ther. 2002 Aug;302(2):545-50. [PubMed:12130714]
  8. Mathur R, Choi WS, Eldstrom J, Wang Z, Kim J, Steele DF, Fedida D: A specific N-terminal residue in Kv1.5 is required for upregulation of the channel by SAP97. Biochem Biophys Res Commun. 2006 Mar 31;342(1):1-8. Epub 2006 Jan 31. [PubMed:16466689]
  9. Olson TM, Alekseev AE, Liu XK, Park S, Zingman LV, Bienengraeber M, Sattiraju S, Ballew JD, Jahangir A, Terzic A: Kv1.5 channelopathy due to KCNA5 loss-of-function mutation causes human atrial fibrillation. Hum Mol Genet. 2006 Jul 15;15(14):2185-91. Epub 2006 Jun 13. [PubMed:16772329]
  10. Benson MD, Li QJ, Kieckhafer K, Dudek D, Whorton MR, Sunahara RK, Iniguez-Lluhi JA, Martens JR: SUMO modification regulates inactivation of the voltage-gated potassium channel Kv1.5. Proc Natl Acad Sci U S A. 2007 Feb 6;104(6):1805-10. Epub 2007 Jan 29. [PubMed:17261810]
  11. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. [PubMed:16959974]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB06637DalfampridineapprovedyesantagonistDetails
DB06217Vernakalantapproved, investigationalyesblockerDetails
DB11633Isavuconazoleapproved, investigationalnoinhibitorDetails
DB00228Enfluraneapproved, investigational, vet_approvedunknowninhibitoractivatorDetails
DB01069Promethazineapproved, investigationalunknowninducerDetails
DB01110Miconazoleapproved, investigational, vet_approvedunknowninhibitorDetails