Integrin beta-7

Details

Name
Integrin beta-7
Synonyms
  • Gut homing receptor beta subunit
Gene Name
ITGB7
Organism
Humans
Amino acid sequence
>lcl|BSEQ0006662|Integrin beta-7
MVALPMVLVLLLVLSRGESELDAKIPSTGDATEWRNPHLSMLGSCQPAPSCQKCILSHPS
CAWCKQLNFTASGEAEARRCARREELLARGCPLEELEEPRGQQEVLQDQPLSQGARGEGA
TQLAPQRVRVTLRPGEPQQLQVRFLRAEGYPVDLYYLMDLSYSMKDDLERVRQLGHALLV
RLQEVTHSVRIGFGSFVDKTVLPFVSTVPSKLRHPCPTRLERCQSPFSFHHVLSLTGDAQ
AFEREVGRQSVSGNLDSPEGGFDAILQAALCQEQIGWRNVSRLLVFTSDDTFHTAGDGKL
GGIFMPSDGHCHLDSNGLYSRSTEFDYPSVGQVAQALSAANIQPIFAVTSAALPVYQELS
KLIPKSAVGELSEDSSNVVQLIMDAYNSLSSTVTLEHSSLPPGVHISYESQCEGPEKREG
KAEDRGQCNHVRINQTVTFWVSLQATHCLPEPHLLRLRALGFSEELIVELHTLCDCNCSD
TQPQAPHCSDGQGHLQCGVCSCAPGRLGRLCECSVAELSSPDLESGCRAPNGTGPLCSGK
GHCQCGRCSCSGQSSGHLCECDDASCERHEGILCGGFGRCQCGVCHCHANRTGRACECSG
DMDSCISPEGGLCSGHGRCKCNRCQCLDGYYGALCDQCPGCKTPCERHRDCAECGAFRTG
PLATNCSTACAHTNVTLALAPILDDGWCKERTLDNQLFFFLVEDDARGTVVLRVRPQEKG
ADHTQAIVLGCVGGIVAVGLGLVLAYRLSVEIYDRREYSRFEKEQQQLNWKQDSNPLYKS
AITTTINPRFQEADSPTL
Number of residues
798
Molecular Weight
86902.415
Theoretical pI
5.95
GO Classification
Functions
cell adhesion molecule binding / metal ion binding / virus receptor activity
Processes
cell adhesion / cell-matrix adhesion / cell-matrix adhesion involved in ameboidal cell migration / extracellular matrix organization / heterotypic cell-cell adhesion / integrin-mediated signaling pathway / leukocyte tethering or rolling / receptor clustering / regulation of immune response / substrate adhesion-dependent cell spreading / T cell migration
Components
cell surface / extracellular exosome / integrin alpha4-beta7 complex / integrin complex / membrane / plasma membrane / receptor complex
General Function
Virus receptor activity
Specific Function
Integrin alpha-4/beta-7 (Peyer patches-specific homing receptor LPAM-1) is an adhesion molecule that mediates lymphocyte migration and homing to gut-associated lymphoid tissue (GALT). Integrin alpha-4/beta-7 interacts with the cell surface adhesion molecules MADCAM1 which is normally expressed by the vascular endothelium of the gastrointestinal tract. Interacts also with VCAM1 and fibronectin, an extracellular matrix component. It recognizes one or more domains within the alternatively spliced CS-1 region of fibronectin. Interactions involves the tripeptide L-D-T in MADCAM1, and L-D-V in fibronectin. Binds to HIV-1 gp120, thereby allowing the virus to enter GALT, which is thought to be the major trigger of AIDS disease. Interaction would involve a tripeptide L-D-I in HIV-1 gp120. Integrin alpha-E/beta-7 (HML-1) is a receptor for E-cadherin.
Pfam Domain Function
Transmembrane Regions
724-746
Cellular Location
Membrane
Gene sequence
>lcl|BSEQ0019419|Integrin beta-7 (ITGB7)
ATGGTGGCTTTGCCAATGGTCCTTGTTTTGCTGCTGGTCCTGAGCAGAGGTGAGAGTGAA
TTGGACGCCAAGATCCCATCCACAGGGGATGCCACAGAATGGCGGAATCCTCACCTGTCC
ATGCTGGGGTCCTGCCAGCCAGCCCCCTCCTGCCAGAAGTGCATCCTCTCACACCCCAGC
TGTGCATGGTGCAAGCAACTGAACTTCACCGCGTCGGGAGAGGCGGAGGCGCGGCGCTGC
GCCCGACGAGAGGAGCTGCTGGCTCGAGGCTGCCCGCTGGAGGAGCTGGAGGAGCCCCGC
GGCCAGCAGGAGGTGCTGCAGGACCAGCCGCTCAGCCAGGGCGCCCGCGGAGAGGGTGCC
ACCCAGCTGGCGCCGCAGCGGGTCCGGGTCACGCTGCGGCCTGGGGAGCCCCAGCAGCTC
CAGGTCCGCTTCCTTCGTGCTGAGGGATACCCGGTGGACCTGTACTACCTTATGGACCTG
AGCTACTCCATGAAGGACGACCTGGAACGCGTGCGCCAGCTCGGGCACGCTCTGCTGGTC
CGGCTGCAGGAAGTCACCCATTCTGTGCGCATTGGTTTTGGTTCCTTTGTGGACAAAACG
GTGCTGCCCTTTGTGAGCACAGTACCCTCCAAACTGCGCCACCCCTGCCCCACCCGGCTG
GAGCGCTGCCAGTCACCATTCAGCTTTCACCATGTGCTGTCCCTGACGGGGGACGCACAA
GCCTTCGAGCGGGAGGTGGGGCGCCAGAGTGTGTCCGGCAATCTGGACTCGCCTGAAGGT
GGCTTCGATGCCATTCTGCAGGCTGCACTCTGCCAGGAGCAGATTGGCTGGAGAAATGTG
TCCCGGCTGCTGGTGTTCACTTCAGACGACACATTCCATACAGCTGGGGACGGGAAGTTG
GGCGGCATTTTCATGCCCAGTGATGGGCACTGCCACTTGGACAGCAATGGCCTCTACAGT
CGCAGCACAGAGTTTGACTACCCTTCTGTGGGTCAGGTAGCCCAGGCCCTCTCTGCAGCA
AATATCCAGCCCATCTTTGCTGTCACCAGTGCCGCACTGCCTGTCTACCAGGAGCTGAGT
AAACTGATTCCTAAGTCTGCAGTTGGGGAGCTGAGTGAGGACTCCAGCAACGTGGTACAG
CTCATCATGGATGCTTATAATAGCCTGTCTTCCACCGTGACCCTTGAACACTCTTCACTC
CCTCCTGGGGTCCACATTTCTTACGAATCCCAGTGTGAGGGTCCTGAGAAGAGGGAGGGT
AAGGCTGAGGATCGAGGACAGTGCAACCACGTCCGAATCAACCAGACGGTGACTTTCTGG
GTTTCTCTCCAAGCCACCCACTGCCTCCCAGAGCCCCATCTCCTGAGGCTCCGGGCCCTT
GGCTTCTCAGAGGAGCTGATTGTGGAGTTGCACACGCTGTGTGACTGTAATTGCAGTGAC
ACCCAGCCCCAGGCTCCCCACTGCAGTGATGGCCAGGGACACCTACAATGTGGTGTATGC
AGCTGTGCCCCTGGCCGCCTAGGTCGGCTCTGTGAGTGCTCTGTGGCAGAGCTGTCCTCC
CCAGACCTGGAATCTGGGTGCCGGGCTCCCAATGGCACAGGGCCCCTGTGCAGTGGAAAG
GGTCACTGTCAATGTGGACGCTGCAGCTGCAGTGGACAGAGCTCTGGGCATCTGTGCGAG
TGTGACGATGCCAGCTGTGAGCGACATGAGGGCATCCTCTGCGGAGGCTTTGGTCGCTGC
CAATGTGGAGTATGTCACTGTCATGCCAACCGCACGGGCAGAGCATGCGAATGCAGTGGG
GACATGGACAGTTGCATCAGTCCCGAGGGAGGGCTCTGCAGTGGGCATGGACGCTGCAAA
TGCAACCGCTGCCAGTGCTTGGACGGCTACTATGGTGCTCTATGCGACCAATGCCCAGGC
TGCAAGACACCATGCGAGAGACACCGGGACTGTGCAGAGTGTGGGGCCTTCAGGACTGGC
CCACTGGCCACCAACTGCAGTACAGCTTGTGCCCATACCAATGTGACCCTGGCCTTGGCC
CCTATCTTGGATGATGGCTGGTGCAAAGAGCGGACCCTGGACAACCAGCTGTTCTTCTTC
TTGGTGGAGGATGACGCCAGAGGCACGGTCGTGCTCAGAGTGAGACCCCAAGAAAAGGGA
GCAGACCACACGCAGGCCATTGTGCTGGGCTGCGTAGGGGGCATCGTGGCAGTGGGGCTG
GGGCTGGTCCTGGCTTACCGGCTCTCGGTGGAAATCTATGACCGCCGGGAATACAGTCGC
TTTGAGAAGGAGCAGCAACAACTCAACTGGAAGCAGGACAGTAATCCTCTCTACAAAAGT
GCCATCACGACCACCATCAATCCTCGCTTTCAAGAGGCAGACAGTCCCACTCTCTGA
Chromosome Location
12
Locus
12q13.13
External Identifiers
ResourceLink
UniProtKB IDP26010
UniProtKB Entry NameITB7_HUMAN
GenBank Gene IDS80335
GenAtlas IDITGB7
HGNC IDHGNC:6162
General References
  1. Yuan QA, Jiang WM, Krissansen GW, Watson JD: Cloning and sequence analysis of a novel beta 2-related integrin transcript from T lymphocytes: homology of integrin cysteine-rich repeats to domain III of laminin B chains. Int Immunol. 1990;2(11):1097-108. [Article]
  2. Yuan QA, Jiang WM, Krissansen GW, Watson JD: Cloning and sequence analysis of a novel beta 2-related integrin transcript from T lymphocytes: homology of integrin cysteine-rich repeats to domain III of laminin B chains. Int Immunol. 1991 Dec;3(12):1373-4. [Article]
  3. Erle DJ, Ruegg C, Sheppard D, Pytela R: Complete amino acid sequence of an integrin beta subunit (beta 7) identified in leukocytes. J Biol Chem. 1991 Jun 15;266(17):11009-16. [Article]
  4. Jiang WM, Jenkins D, Yuan Q, Leung E, Choo KH, Watson JD, Krissansen GW: The gene organization of the human beta 7 subunit, the common beta subunit of the leukocyte integrins HML-1 and LPAM-1. Int Immunol. 1992 Sep;4(9):1031-40. [Article]
  5. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
  6. Parker CM, Cepek KL, Russell GJ, Shaw SK, Posnett DN, Schwarting R, Brenner MB: A family of beta 7 integrins on human mucosal lymphocytes. Proc Natl Acad Sci U S A. 1992 Mar 1;89(5):1924-8. [Article]
  7. Micklem KJ, Dong Y, Willis A, Pulford KA, Visser L, Durkop H, Poppema S, Stein H, Mason DY: HML-1 antigen on mucosa-associated T cells, activated cells, and hairy leukemic cells is a new integrin containing the beta 7 subunit. Am J Pathol. 1991 Dec;139(6):1297-301. [Article]
  8. Higgins JM, Cernadas M, Tan K, Irie A, Wang J, Takada Y, Brenner MB: The role of alpha and beta chains in ligand recognition by beta 7 integrins. J Biol Chem. 2000 Aug 18;275(33):25652-64. [Article]
  9. Hynes RO: Integrins: bidirectional, allosteric signaling machines. Cell. 2002 Sep 20;110(6):673-87. [Article]
  10. Arthos J, Cicala C, Martinelli E, Macleod K, Van Ryk D, Wei D, Xiao Z, Veenstra TD, Conrad TP, Lempicki RA, McLaughlin S, Pascuccio M, Gopaul R, McNally J, Cruz CC, Censoplano N, Chung E, Reitano KN, Kottilil S, Goode DJ, Fauci AS: HIV-1 envelope protein binds to and signals through integrin alpha4beta7, the gut mucosal homing receptor for peripheral T cells. Nat Immunol. 2008 Mar;9(3):301-9. doi: 10.1038/ni1566. Epub 2008 Feb 10. [Article]
  11. Kiema T, Lad Y, Jiang P, Oxley CL, Baldassarre M, Wegener KL, Campbell ID, Ylanne J, Calderwood DA: The molecular basis of filamin binding to integrins and competition with talin. Mol Cell. 2006 Feb 3;21(3):337-47. [Article]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB05122R1295investigationalunknownDetails
DB09033VedolizumabapprovedyesantibodyDetails