B2 bradykinin receptor

Details

Name
B2 bradykinin receptor
Synonyms
  • B2R
  • BKR2
Gene Name
BDKRB2
Organism
Humans
Amino acid sequence
>lcl|BSEQ0006785|B2 bradykinin receptor
MFSPWKISMFLSVREDSVPTTASFSADMLNVTLQGPTLNGTFAQSKCPQVEWLGWLNTIQ
PPFLWVLFVLATLENIFVLSVFCLHKSSCTVAEIYLGNLAAADLILACGLPFWAITISNN
FDWLFGETLCRVVNAIISMNLYSSICFLMLVSIDRYLALVKTMSMGRMRGVRWAKLYSLV
IWGCTLLLSSPMLVFRTMKEYSDEGHNVTACVISYPSLIWEVFTNMLLNVVGFLLPLSVI
TFCTMQIMQVLRNNEMQKFKEIQTERRATVLVLVVLLLFIICWLPFQISTFLDTLHRLGI
LSSCQDERIIDVITQIASFMAYSNSCLNPLVYVIVGKRFRKKSWEVYQGVCQKGGCRSEP
IQMENSMGTLRTSISVERQIHKLQDWAGSRQ
Number of residues
391
Molecular Weight
44460.15
Theoretical pI
8.2
GO Classification
Functions
bradykinin receptor activity / phosphatidylinositol phospholipase C activity / protease binding / protein heterodimerization activity / type 1 angiotensin receptor binding
Processes
acute inflammatory response to antigenic stimulus / arachidonic acid secretion / blood circulation / cell surface receptor signaling pathway / cellular response to hypoxia / G-protein coupled receptor signaling pathway / inflammatory response / maintenance of blood-brain barrier / negative regulation of blood pressure / negative regulation of cell proliferation / negative regulation of intrinsic apoptotic signaling pathway in response to osmotic stress by p53 class mediator / negative regulation of peptidyl-serine phosphorylation / positive regulation of cytosolic calcium ion concentration / regulation of vascular permeability / regulation of vasoconstriction / response to drug / response to salt stress / smooth muscle contraction / transmembrane receptor protein tyrosine kinase signaling pathway / vasoconstriction / vasodilation
Components
cytosol / endosome / integral component of plasma membrane / plasma membrane
General Function
Type 1 angiotensin receptor binding
Specific Function
Receptor for bradykinin. It is associated with G proteins that activate a phosphatidylinositol-calcium second messenger system.
Pfam Domain Function
Transmembrane Regions
61-84 94-118 132-153 176-198 222-248 268-292 312-335
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0017128|B2 bradykinin receptor (BDKRB2)
ATGTTCTCTCCCTGGAAGATATCAATGTTTCTGTCTGTTCGTGAGGACTCCGTGCCCACC
ACGGCCTCTTTCAGCGCCGACATGCTCAATGTCACCTTGCAAGGGCCCACTCTTAACGGG
ACCTTTGCCCAGAGCAAATGCCCCCAAGTGGAGTGGCTGGGCTGGCTCAACACCATCCAG
CCCCCCTTCCTCTGGGTGCTGTTCGTGCTGGCCACCCTAGAGAACATCTTTGTCCTCAGC
GTCTTCTGCCTGCACAAGAGCAGCTGCACGGTGGCAGAGATCTACCTGGGGAACCTGGCC
GCAGCAGACCTGATCCTGGCCTGCGGGCTGCCCTTCTGGGCCATCACCATCTCCAACAAC
TTCGACTGGCTCTTTGGGGAGACGCTCTGCCGCGTGGTGAATGCCATTATCTCCATGAAC
CTGTACAGCAGCATCTGTTTCCTGATGCTGGTGAGCATCGACCGCTACCTGGCCCTGGTG
AAAACCATGTCCATGGGCCGGATGCGCGGCGTGCGCTGGGCCAAGCTCTACAGCTTGGTG
ATCTGGGGGTGTACGCTGCTCCTGAGCTCACCCATGCTGGTGTTCCGGACCATGAAGGAG
TACAGCGATGAGGGCCACAACGTCACCGCTTGTGTCATCAGCTACCCATCCCTCATCTGG
GAAGTGTTCACCAACATGCTCCTGAATGTCGTGGGCTTCCTGCTGCCCCTGAGTGTCATC
ACCTTCTGCACGATGCAGATCATGCAGGTGCTGCGGAACAACGAGATGCAGAAGTTCAAG
GAGATCCAGACAGAGAGGAGGGCCACGGTGCTAGTCCTGGTTGTGCTGCTGCTATTCATC
ATCTGCTGGCTGCCCTTCCAGATCAGCACCTTCCTGGATACGCTGCATCGCCTCGGCATC
CTCTCCAGCTGCCAGGACGAGCGCATCATCGATGTAATCACACAGATCGCCTCCTTCATG
GCCTACAGCAACAGCTGCCTCAACCCACTGGTGTACGTGATCGTGGGCAAGCGCTTCCGA
AAGAAGTCTTGGGAGGTGTACCAGGGAGTGTGCCAGAAAGGGGGCTGCAGGTCAGAACCC
ATTCAGATGGAGAACTCCATGGGCACACTGCGGACCTCCATCTCCGTGGAACGCCAGATT
CACAAACTGCAGGACTGGGCAGGGAGCAGACAGTGA
Chromosome Location
14
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP30411
UniProtKB Entry NameBKRB2_HUMAN
GenBank Gene IDBC074895
GenAtlas IDBDKRB2
HGNC IDHGNC:1030
General References
  1. Hess JF, Borkowski JA, Young GS, Strader CD, Ransom RW: Cloning and pharmacological characterization of a human bradykinin (BK-2) receptor. Biochem Biophys Res Commun. 1992 Apr 15;184(1):260-8. [Article]
  2. Powell SJ, Slynn G, Thomas C, Hopkins B, Briggs I, Graham A: Human bradykinin B2 receptor: nucleotide sequence analysis and assignment to chromosome 14. Genomics. 1993 Feb;15(2):435-8. [Article]
  3. McIntyre P, Phillips E, Skidmore E, Brown M, Webb M: Cloned murine bradykinin receptor exhibits a mixed B1 and B2 pharmacological selectivity. Mol Pharmacol. 1993 Aug;44(2):346-55. [Article]
  4. Eggerickx D, Raspe E, Bertrand D, Vassart G, Parmentier M: Molecular cloning, functional expression and pharmacological characterization of a human bradykinin B2 receptor gene. Biochem Biophys Res Commun. 1992 Sep 30;187(3):1306-13. [Article]
  5. Ma JX, Wang DZ, Ward DC, Chen L, Dessai T, Chao J, Chao L: Structure and chromosomal localization of the gene (BDKRB2) encoding human bradykinin B2 receptor. Genomics. 1994 Sep 15;23(2):362-9. [Article]
  6. Braun A, Kammerer S, Bohme E, Muller B, Roscher AA: Identification of polymorphic sites of the human bradykinin B2 receptor gene. Biochem Biophys Res Commun. 1995 Jun 6;211(1):234-40. [Article]
  7. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
  8. AbdAlla S, Godovac-Zimmermann J, Braun A, Roscher AA, Muller-Esterl W, Quitterer U: Structure of the bradykinin B2 receptors' amino terminus. Biochemistry. 1996 Jun 11;35(23):7514-9. [Article]
  9. Yeh JC, Otte LA, Frangos JA: Regulation of G protein-coupled receptor activities by the platelet-endothelial cell adhesion molecule, PECAM-1. Biochemistry. 2008 Aug 26;47(34):9029-39. doi: 10.1021/bi8003846. Epub 2008 Aug 2. [Article]
  10. Blaukat A, Pizard A, Breit A, Wernstedt C, Alhenc-Gelas F, Muller-Esterl W, Dikic I: Determination of bradykinin B2 receptor in vivo phosphorylation sites and their role in receptor function. J Biol Chem. 2001 Nov 2;276(44):40431-40. Epub 2001 Aug 21. [Article]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB06196Icatibantapproved, investigationalyesantagonistDetails
DB06549LabradimilinvestigationalunknownagonistDetails
DB05038AnatibantinvestigationalunknownantagonistDetails