Delta-type opioid receptor
Details
- Name
- Delta-type opioid receptor
- Synonyms
- D-OR-1
- DOR-1
- OPRD
- Gene Name
- OPRD1
- UniProtKB Entry
- P41143Swiss-Prot
- Organism
- Humans
- NCBI Taxonomy ID
- 9606
- Amino acid sequence
>lcl|BSEQ0010290|Delta-type opioid receptor MEPAPSAGAELQPPLFANASDAYPSACPSAGANASGPPGARSASSLALAIAITALYSAVC AVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG VPIMVMAVTRPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAAL HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCGRPDPSSFSRAREATARERVTAC TPSDGPGGGAAA
- Number of residues
- 372
- Molecular Weight
- 40368.235
- Theoretical pI
- 9.17
- GO Classification
- Functionsneuropeptide bindingProcessesadult locomotory behavior / cellular response to growth factor stimulus / cellular response to hypoxia / cellular response to toxic substance / eating behavior / immune response / negative regulation of gene expression / neuropeptide signaling pathway / positive regulation of CREB transcription factor activity / positive regulation of peptidyl-serine phosphorylation / regulation of calcium ion transport / regulation of mitochondrial membrane potentialComponentsaxon terminus / dendrite membrane / neuron projection / plasma membrane
- General Function
- G-protein coupled receptor that functions as a receptor for endogenous enkephalins and for a subset of other opioids. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors, such as adenylate cyclase. Signaling leads to the inhibition of adenylate cyclase activity. Inhibits neurotransmitter release by reducing calcium ion currents and increasing potassium ion conductance. Plays a role in the perception of pain and in opiate-mediated analgesia. Plays a role in developing analgesic tolerance to morphine
- Specific Function
- G protein-coupled enkephalin receptor activity
- Pfam Domain Function
- 7tm_1 (PF00001)
- Signal Regions
- Not Available
- Transmembrane Regions
- 48-75 86-110 123-144 164-186 207-238 262-284 300-321
- Cellular Location
- Cell membrane
- Gene sequence
>lcl|BSEQ0010291|Delta-type opioid receptor (OPRD1) ATGGAACCGGCCCCCTCCGCCGGCGCCGAGCTGCAGCCCCCGCTCTTCGCCAACGCCTCG GACGCCTACCCTAGCGCCTGCCCCAGCGCTGGCGCCAATGCGTCGGGGCCGCCAGGCGCG CGGAGCGCCTCGTCCCTCGCCCTGGCAATCGCCATCACCGCGCTCTACTCGGCCGTGTGC GCCGTGGGGCTGCTGGGCAACGTGCTTGTCATGTTCGGCATCGTCCGGTACACTAAGATG AAGACGGCCACCAACATCTACATCTTCAACCTGGCCTTAGCCGATGCGCTGGCCACCAGC ACGCTGCCTTTCCAGAGTGCCAAGTACCTGATGGAGACGTGGCCCTTCGGCGAGCTGCTC TGCAAGGCTGTGCTCTCCATCGACTACTACAATATGTTCACCAGCATCTTCACGCTCACC ATGATGAGTGTTGACCGCTACATCGCTGTCTGCCACCCTGTCAAGGCCCTGGACTTCCGC ACGCCTGCCAAGGCCAAGCTGATCAACATCTGTATCTGGGTCCTGGCCTCAGGCGTTGGC GTGCCCATCATGGTCATGGCTGTGACCCGTCCCCGGGACGGGGCAGTGGTGTGCATGCTC CAGTTCCCCAGCCCCAGCTGGTACTGGGACACGGTGACCAAGATCTGCGTGTTCCTCTTC GCCTTCGTGGTGCCCATCCTCATCATCACCGTGTGCTATGGCCTCATGCTGCTGCGCCTG CGCAGTGTGCGCCTGCTGTCGGGCTCCAAGGAGAAGGACCGCAGCCTGCGGCGCATCACG CGCATGGTGCTGGTGGTTGTGGGCGCCTTCGTGGTGTGTTGGGCGCCCATCCACATCTTC GTCATCGTCTGGACGCTGGTGGACATCGACCGGCGCGACCCGCTGGTGGTGGCTGCGCTG CACCTGTGCATCGCGCTGGGCTACGCCAATAGCAGCCTCAACCCCGTGCTCTACGCTTTC CTCGACGAGAACTTCAAGCGCTGCTTCCGCCAGCTCTGCCGCAAGCCCTGCGGCCGCCCA GACCCCAGCAGCTTCAGCCGCGCCCGCGAAGCCACGGCCCGCGAGCGTGTCACCGCCTGC ACCCCGTCCGATGGTCCCGGCGGTGGCGCTGCCGCCTGA
- Chromosome Location
- 1
- Locus
- 1p35.3
- External Identifiers
Resource Link UniProtKB ID P41143 UniProtKB Entry Name OPRD_HUMAN GenBank Protein ID 27545517 GenBank Gene ID U07882 GeneCard ID OPRD1 GenAtlas ID OPRD1 HGNC ID HGNC:8153 PDB ID(s) 4N6H, 4RWA, 4RWD, 6PT2, 6PT3, 8F7S KEGG ID hsa:4985 IUPHAR/Guide To Pharmacology ID 317 NCBI Gene ID 4985 - General References
- Knapp RJ, Malatynska E, Fang L, Li X, Babin E, Nguyen M, Santoro G, Varga EV, Hruby VJ, Roeske WR, et al.: Identification of a human delta opioid receptor: cloning and expression. Life Sci. 1994;54(25):PL463-9. [Article]
- Simonin F, Befort K, Gaveriaux-Ruff C, Matthes H, Nappey V, Lannes B, Micheletti G, Kieffer B: The human delta-opioid receptor: genomic organization, cDNA cloning, functional expression, and distribution in human brain. Mol Pharmacol. 1994 Dec;46(6):1015-21. [Article]
- Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [Article]
- Whistler JL, Enquist J, Marley A, Fong J, Gladher F, Tsuruda P, Murray SR, Von Zastrow M: Modulation of postendocytic sorting of G protein-coupled receptors. Science. 2002 Jul 26;297(5581):615-20. [Article]
- Simonin F, Karcher P, Boeuf JJ, Matifas A, Kieffer BL: Identification of a novel family of G protein-coupled receptor associated sorting proteins. J Neurochem. 2004 May;89(3):766-75. [Article]
- Leskela TT, Lackman JJ, Vierimaa MM, Kobayashi H, Bouvier M, Petaja-Repo UE: Cys-27 variant of human delta-opioid receptor modulates maturation and cell surface delivery of Phe-27 variant via heteromerization. J Biol Chem. 2012 Feb 10;287(7):5008-20. doi: 10.1074/jbc.M111.305656. Epub 2011 Dec 19. [Article]
- Agirregoitia E, Peralta L, Mendoza R, Exposito A, Ereno ED, Matorras R, Agirregoitia N: Expression and localization of opioid receptors during the maturation of human oocytes. Reprod Biomed Online. 2012 May;24(5):550-7. doi: 10.1016/j.rbmo.2012.02.007. Epub 2012 Feb 22. [Article]
- Gelernter J, Kranzler HR: Variant detection at the delta opioid receptor (OPRD1) locus and population genetics of a novel variant affecting protein sequence. Hum Genet. 2000 Jul;107(1):86-8. [Article]
- Decaillot FM, Befort K, Filliol D, Yue S, Walker P, Kieffer BL: Opioid receptor random mutagenesis reveals a mechanism for G protein-coupled receptor activation. Nat Struct Biol. 2003 Aug;10(8):629-36. [Article]
Associated Data
- Bio-Entities
Bio-Entity Type Delta-type opioid receptor (Humans) protein primary- Drug Relations
Drug Drug group Pharmacological action? Type Actions Details Codeine approved, illicit yes target agonist Details Hydromorphone approved, illicit yes target partial agonist Details Dextropropoxyphene approved, illicit, investigational, withdrawn yes target agonist Details Nalbuphine approved yes target antagonist Details Hydrocodone approved, illicit, investigational yes target agonist Details Morphine approved, investigational yes target agonist Details Butorphanol approved, illicit, vet_approved yes target agonist Details Fentanyl approved, illicit, investigational, vet_approved yes target agonist Details Naloxone approved, vet_approved yes target antagonist Details Etorphine illicit, vet_approved yes target agonist Details Diprenorphine illicit, vet_approved yes target antagonist Details 3-Methylthiofentanyl experimental, illicit yes target agonist Details Dimethylthiambutene experimental, illicit yes target agonist Details Loperamide approved unknown target agonist Details Naltrexone approved, investigational, vet_approved yes target antagonist Details 3-Methylfentanyl illicit yes target agonist Details ADL5859 investigational unknown target Details Oxycodone approved, illicit, investigational yes target agonist Details DPI-221 investigational unknown target Details Tapentadol approved unknown target agonist Details Morphine glucuronide investigational unknown target Details Diamorphine approved, illicit, investigational unknown target agonist Details Tramadol approved, investigational unknown target agonist Details Methadone approved yes target agonist Details Sufentanil approved, investigational unknown target agonist Details Carfentanil illicit, investigational, vet_approved yes target agonist Details Oxymorphone approved, investigational, vet_approved unknown target antagonist Details Amitriptyline approved unknown target agonist Details Diphenoxylate approved, illicit unknown target agonist Details Levorphanol approved unknown target agonist Details Dihydromorphine experimental, illicit yes target agonist Details Buprenorphine approved, illicit, investigational, vet_approved unknown target antagonist Details Alvimopan approved, investigational unknown target antagonist Details Remifentanil approved unknown target agonist Details Ketobemidone investigational yes target agonist Details Dextromethorphan approved unknown target agonist Details Ketamine approved, vet_approved unknown target binder Details Eluxadoline approved, investigational yes target antagonist Details Naldemedine approved, investigational yes target antagonist Details Nalmefene approved, investigational, withdrawn yes target antagonist Details Cannabidiol approved, investigational unknown target Details Pholcodine approved, illicit unknown target antagonist Details Opium approved, illicit yes target agonist Details Nabiximols investigational unknown target Details Medical Cannabis experimental, investigational unknown target Details Loxicodegol investigational unknown target agonist Details Butyrfentanyl illicit unknown target agonist Details Aripiprazole approved, investigational unknown target ligand Details Metenkefalin investigational yes target agonist Details Amisulpride approved, investigational no target agonist Details Samidorphan approved, investigational unknown target partial agonist Details DADLE experimental yes target agonist Details Somatostatin approved, investigational yes target inhibitor Details DPDPE experimental yes target inhibitor Details Lofentanil illicit yes target inhibitor Details Dimepheptanol investigational yes target inhibitor Details Etonitazene experimental, illicit yes target inhibitor Details Salvinorin A investigational yes target inhibitor Details Dynorphin investigational yes target inhibitor Details