Delta-type opioid receptor
Details
- Name
- Delta-type opioid receptor
- Synonyms
- D-OR-1
- OPRD
- Gene Name
- OPRD1
- Organism
- Humans
- Amino acid sequence
>lcl|BSEQ0010290|Delta-type opioid receptor MEPAPSAGAELQPPLFANASDAYPSACPSAGANASGPPGARSASSLALAIAITALYSAVC AVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG VPIMVMAVTRPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAAL HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCGRPDPSSFSRAREATARERVTAC TPSDGPGGGAAA
- Number of residues
- 372
- Molecular Weight
- 40368.235
- Theoretical pI
- 9.17
- GO Classification
- Functionsenkephalin receptor activity / neuropeptide binding / opioid receptor activityProcessesadenylate cyclase-inhibiting G-protein coupled receptor signaling pathway / adult locomotory behavior / cellular response to growth factor stimulus / cellular response to hypoxia / cellular response to toxic substance / eating behavior / G-protein coupled receptor signaling pathway / G-protein coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger / immune response / negative regulation of gene expression / negative regulation of protein oligomerization / neuropeptide signaling pathway / opioid receptor signaling pathway / phospholipase C-activating G-protein coupled receptor signaling pathway / positive regulation of CREB transcription factor activity / positive regulation of peptidyl-serine phosphorylation / protein import into nucleus, translocation / regulation of calcium ion transport / regulation of mitochondrial membrane potential / regulation of sensory perception of pain / synaptic transmissionComponentsaxon terminus / cytoplasm / dendrite membrane / integral component of plasma membrane / intrinsic component of plasma membrane / membrane raft / neuron projection / plasma membrane / postsynaptic membrane / vesicle
- General Function
- Opioid receptor activity
- Specific Function
- G-protein coupled receptor that functions as receptor for endogenous enkephalins and for a subset of other opioids. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors, such as adenylate cyclase. Signaling leads to the inhibition of adenylate cyclase activity. Inhibits neurotransmitter release by reducing calcium ion currents and increasing potassium ion conductance. Plays a role in the perception of pain and in opiate-mediated analgesia. Plays a role in developing analgesic tolerance to morphine.
- Pfam Domain Function
- 7tm_1 (PF00001)
- Transmembrane Regions
- 48-75 86-110 123-144 164-186 207-238 262-284 300-321
- Cellular Location
- Cell membrane
- Gene sequence
>lcl|BSEQ0010291|Delta-type opioid receptor (OPRD1) ATGGAACCGGCCCCCTCCGCCGGCGCCGAGCTGCAGCCCCCGCTCTTCGCCAACGCCTCG GACGCCTACCCTAGCGCCTGCCCCAGCGCTGGCGCCAATGCGTCGGGGCCGCCAGGCGCG CGGAGCGCCTCGTCCCTCGCCCTGGCAATCGCCATCACCGCGCTCTACTCGGCCGTGTGC GCCGTGGGGCTGCTGGGCAACGTGCTTGTCATGTTCGGCATCGTCCGGTACACTAAGATG AAGACGGCCACCAACATCTACATCTTCAACCTGGCCTTAGCCGATGCGCTGGCCACCAGC ACGCTGCCTTTCCAGAGTGCCAAGTACCTGATGGAGACGTGGCCCTTCGGCGAGCTGCTC TGCAAGGCTGTGCTCTCCATCGACTACTACAATATGTTCACCAGCATCTTCACGCTCACC ATGATGAGTGTTGACCGCTACATCGCTGTCTGCCACCCTGTCAAGGCCCTGGACTTCCGC ACGCCTGCCAAGGCCAAGCTGATCAACATCTGTATCTGGGTCCTGGCCTCAGGCGTTGGC GTGCCCATCATGGTCATGGCTGTGACCCGTCCCCGGGACGGGGCAGTGGTGTGCATGCTC CAGTTCCCCAGCCCCAGCTGGTACTGGGACACGGTGACCAAGATCTGCGTGTTCCTCTTC GCCTTCGTGGTGCCCATCCTCATCATCACCGTGTGCTATGGCCTCATGCTGCTGCGCCTG CGCAGTGTGCGCCTGCTGTCGGGCTCCAAGGAGAAGGACCGCAGCCTGCGGCGCATCACG CGCATGGTGCTGGTGGTTGTGGGCGCCTTCGTGGTGTGTTGGGCGCCCATCCACATCTTC GTCATCGTCTGGACGCTGGTGGACATCGACCGGCGCGACCCGCTGGTGGTGGCTGCGCTG CACCTGTGCATCGCGCTGGGCTACGCCAATAGCAGCCTCAACCCCGTGCTCTACGCTTTC CTCGACGAGAACTTCAAGCGCTGCTTCCGCCAGCTCTGCCGCAAGCCCTGCGGCCGCCCA GACCCCAGCAGCTTCAGCCGCGCCCGCGAAGCCACGGCCCGCGAGCGTGTCACCGCCTGC ACCCCGTCCGATGGTCCCGGCGGTGGCGCTGCCGCCTGA
- Chromosome Location
- 1
- Locus
- 1p36.1-p34.3
- External Identifiers
Resource Link UniProtKB ID P41143 UniProtKB Entry Name OPRD_HUMAN GenBank Protein ID 27545517 GenBank Gene ID U07882 GenAtlas ID OPRD1 HGNC ID HGNC:8153 - General References
- Knapp RJ, Malatynska E, Fang L, Li X, Babin E, Nguyen M, Santoro G, Varga EV, Hruby VJ, Roeske WR, et al.: Identification of a human delta opioid receptor: cloning and expression. Life Sci. 1994;54(25):PL463-9. [Article]
- Simonin F, Befort K, Gaveriaux-Ruff C, Matthes H, Nappey V, Lannes B, Micheletti G, Kieffer B: The human delta-opioid receptor: genomic organization, cDNA cloning, functional expression, and distribution in human brain. Mol Pharmacol. 1994 Dec;46(6):1015-21. [Article]
- Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [Article]
- Whistler JL, Enquist J, Marley A, Fong J, Gladher F, Tsuruda P, Murray SR, Von Zastrow M: Modulation of postendocytic sorting of G protein-coupled receptors. Science. 2002 Jul 26;297(5581):615-20. [Article]
- Simonin F, Karcher P, Boeuf JJ, Matifas A, Kieffer BL: Identification of a novel family of G protein-coupled receptor associated sorting proteins. J Neurochem. 2004 May;89(3):766-75. [Article]
- Leskela TT, Lackman JJ, Vierimaa MM, Kobayashi H, Bouvier M, Petaja-Repo UE: Cys-27 variant of human delta-opioid receptor modulates maturation and cell surface delivery of Phe-27 variant via heteromerization. J Biol Chem. 2012 Feb 10;287(7):5008-20. doi: 10.1074/jbc.M111.305656. Epub 2011 Dec 19. [Article]
- Agirregoitia E, Peralta L, Mendoza R, Exposito A, Ereno ED, Matorras R, Agirregoitia N: Expression and localization of opioid receptors during the maturation of human oocytes. Reprod Biomed Online. 2012 May;24(5):550-7. doi: 10.1016/j.rbmo.2012.02.007. Epub 2012 Feb 22. [Article]
- Gelernter J, Kranzler HR: Variant detection at the delta opioid receptor (OPRD1) locus and population genetics of a novel variant affecting protein sequence. Hum Genet. 2000 Jul;107(1):86-8. [Article]
- Decaillot FM, Befort K, Filliol D, Yue S, Walker P, Kieffer BL: Opioid receptor random mutagenesis reveals a mechanism for G protein-coupled receptor activation. Nat Struct Biol. 2003 Aug;10(8):629-36. [Article]
Drug Relations
- Drug Relations
DrugBank ID Name Drug group Pharmacological action? Actions Details DB00318 Codeine approved, illicit yes agonist Details DB00327 Hydromorphone approved, illicit yes partial agonist Details DB00647 Dextropropoxyphene approved, illicit, investigational, withdrawn yes agonist Details DB00844 Nalbuphine approved yes antagonist Details DB00956 Hydrocodone approved, illicit, investigational yes agonist Details DB00295 Morphine approved, investigational yes agonist Details DB00611 Butorphanol approved, illicit, vet_approved yes agonist Details DB00813 Fentanyl approved, illicit, investigational, vet_approved yes agonist Details DB01183 Naloxone approved, vet_approved yes antagonist Details DB01497 Etorphine illicit, vet_approved yes agonist Details DB01548 Diprenorphine illicit, vet_approved yes antagonist Details DB01439 3-Methylthiofentanyl experimental, illicit yes agonist Details DB01444 Dimethylthiambutene experimental, illicit unknown agonist Details DB00836 Loperamide approved yes agonist Details DB00704 Naltrexone approved, investigational, vet_approved yes antagonist Details DB01571 3-Methylfentanyl illicit yes agonist Details DB05050 ADL5859 investigational unknown Details DB00497 Oxycodone approved, illicit, investigational yes agonist Details DB06204 Tapentadol approved unknown Details DB06409 Morphine glucuronide investigational unknown Details DB01452 Diamorphine approved, illicit, investigational unknown agonist Details DB00193 Tramadol approved, investigational unknown agonist Details DB00333 Methadone approved yes agonist Details DB00708 Sufentanil approved, investigational unknown agonist Details DB01535 Carfentanil illicit, investigational, vet_approved yes agonist Details DB01192 Oxymorphone approved, investigational, vet_approved unknown antagonist Details DB00321 Amitriptyline approved unknown agonist Details DB01081 Diphenoxylate approved, illicit unknown agonist Details DB00854 Levorphanol approved unknown agonist Details DB01565 Dihydromorphine experimental, illicit unknown agonist Details DB00921 Buprenorphine approved, illicit, investigational, vet_approved unknown antagonist Details DB06274 Alvimopan approved, investigational unknown antagonist Details DB00899 Remifentanil approved unknown agonist Details DB06738 Ketobemidone investigational yes agonist Details DB00514 Dextromethorphan approved unknown agonist Details DB01221 Ketamine approved, vet_approved unknown binder Details DB09272 Eluxadoline approved, investigational yes antagonist Details DB11691 Naldemedine approved, investigational yes antagonist Details DB06230 Nalmefene approved, investigational, withdrawn yes antagonist Details DB09061 Cannabidiol approved, investigational unknown Details DB09209 Pholcodine approved, illicit unknown antagonist Details DB11130 Opium approved, illicit yes agonist Details DB14011 Nabiximols investigational unknown Details DB14009 Medical Cannabis experimental, investigational unknown Details DB14146 Loxicodegol investigational unknown agonist Details DB09173 Butyrfentanyl illicit unknown agonist Details DB01238 Aripiprazole approved, investigational unknown ligand Details DB12668 Metenkefalin investigational unknown agonist Details DB06288 Amisulpride approved, investigational no agonist Details DB12543 Samidorphan approved, investigational unknown partial agonist Details