Prostaglandin E2 receptor EP2 subtype
Details
- Name
- Prostaglandin E2 receptor EP2 subtype
- Synonyms
- PGE receptor EP2 subtype
- PGE2 receptor EP2 subtype
- Prostanoid EP2 receptor
- Gene Name
- PTGER2
- UniProtKB Entry
- P43116Swiss-Prot
- Organism
- Humans
- NCBI Taxonomy ID
- 9606
- Amino acid sequence
>lcl|BSEQ0010263|Prostaglandin E2 receptor EP2 subtype MGNASNDSQSEDCETRQWLPPGESPAISSVMFSAGVLGNLIALALLARRWRGDVGCSAGR RSSLSLFHVLVTELVFTDLLGTCLISPVVLASYARNQTLVALAPESRACTYFAFAMTFFS LATMLMLFAMALERYLSIGHPYFYQRRVSRSGGLAVLPVIYAVSLLFCSLPLLDYGQYVQ YCPGTWCFIRHGRTAYLQLYATLLLLLIVSVLACNFSVILNLIRMHRRSRRSRCGPSLGS GRGGPGARRRGERVSMAEETDHLILLAIMTITFAVCSLPFTIFAYMNETSSRKEKWDLQA LRFLSINSIIDPWVFAILRPPVLRLMRSVLCCRISLRTQDATQTSCSTQSDASKQADL
- Number of residues
- 358
- Molecular Weight
- 39759.945
- Theoretical pI
- 9.19
- GO Classification
- Processesadenylate cyclase-activating G protein-coupled receptor signaling pathway / G protein-coupled receptor signaling pathway / inflammatory response / positive regulation of cytosolic calcium ion concentration / regulation of cell population proliferation / response to nematode
- General Function
- Receptor for prostaglandin E2 (PGE2). The activity of this receptor is mediated by G(s) proteins that stimulate adenylate cyclase. The subsequent raise in intracellular cAMP is responsible for the relaxing effect of this receptor on smooth muscle
- Specific Function
- Prostaglandin e receptor activity
- Pfam Domain Function
- 7tm_1 (PF00001)
- Signal Regions
- Not Available
- Transmembrane Regions
- 24-47 66-91 112-132 152-176 199-223 263-286 300-323
- Cellular Location
- Cell membrane
- Gene sequence
>lcl|BSEQ0010264|Prostaglandin E2 receptor EP2 subtype (PTGER2) ATGGGCAATGCCTCCAATGACTCCCAGTCTGAGGACTGCGAGACGCGACAGTGGCTTCCC CCAGGCGAAAGCCCAGCCATCAGCTCCGTCATGTTCTCGGCCGGGGTGCTGGGGAACCTC ATAGCACTGGCGCTGCTGGCGCGCCGCTGGCGGGGGGACGTGGGGTGCAGCGCCGGCCGC AGGAGCTCCCTCTCCTTGTTCCACGTGCTGGTGACCGAGCTGGTGTTCACCGACCTGCTC GGGACCTGCCTCATCAGCCCAGTGGTACTGGCTTCGTACGCGCGGAACCAGACCCTGGTG GCACTGGCGCCCGAGAGCCGCGCGTGCACCTACTTCGCTTTCGCCATGACCTTCTTCAGC CTGGCCACGATGCTCATGCTCTTCGCCATGGCCCTGGAGCGCTACCTCTCGATCGGGCAC CCCTACTTCTACCAGCGCCGCGTCTCGCGCTCCGGGGGCCTGGCCGTGCTGCCTGTCATC TATGCAGTCTCCCTGCTCTTCTGCTCGCTGCCGCTGCTGGACTATGGGCAGTACGTCCAG TACTGCCCCGGGACCTGGTGCTTCATCCGGCACGGGCGGACCGCTTACCTGCAGCTGTAC GCCACCCTGCTGCTGCTTCTCATTGTCTCGGTGCTCGCCTGCAACTTCAGTGTCATTCTC AACCTCATCCGCATGCACCGCCGAAGCCGGAGAAGCCGCTGCGGACCTTCCCTGGGCAGT GGCCGGGGCGGCCCCGGGGCCCGCAGGAGAGGGGAAAGGGTGTCCATGGCGGAGGAGACG GACCACCTCATTCTCCTGGCTATCATGACCATCACCTTCGCCGTCTGCTCCTTGCCTTTC ACGATTTTTGCATATATGAATGAAACCTCTTCCCGAAAGGAAAAATGGGACCTCCAAGCT CTTAGGTTTTTATCAATTAATTCAATAATTGACCCTTGGGTCTTTGCCATCCTTAGGCCT CCTGTTCTGAGACTAATGCGTTCAGTCCTCTGTTGTCGGATTTCATTAAGAACACAAGAT GCAACACAAACTTCCTGTTCTACACAGTCAGATGCCAGTAAACAGGCTGACCTTTGA
- Chromosome Location
- 14
- Locus
- 14q22.1
- External Identifiers
Resource Link UniProtKB ID P43116 UniProtKB Entry Name PE2R2_HUMAN GenBank Protein ID 632650 GenBank Gene ID U19487 GeneCard ID PTGER2 GenAtlas ID PTGER2 HGNC ID HGNC:9594 PDB ID(s) 7CX2, 7CX3, 7CX4 KEGG ID hsa:5732 IUPHAR/Guide To Pharmacology ID 341 NCBI Gene ID 5732 - General References
- Regan JW, Bailey TJ, Pepperl DJ, Pierce KL, Bogardus AM, Donello JE, Fairbairn CE, Kedzie KM, Woodward DF, Gil DW: Cloning of a novel human prostaglandin receptor with characteristics of the pharmacologically defined EP2 subtype. Mol Pharmacol. 1994 Aug;46(2):213-20. [Article]
- Smock SL, Pan LC, Castleberry TA, Lu B, Mather RJ, Owen TA: Cloning, structural characterization, and chromosomal localization of the gene encoding the human prostaglandin E(2) receptor EP2 subtype. Gene. 1999 Sep 17;237(2):393-402. [Article]
- Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
Associated Data
- Bio-Entities
Bio-Entity Type Prostaglandin E2 receptor EP2 subtype (Humans) protein primaryProstaglandin E2 Receptors (Humans) protein - Drug Relations
Drug Drug group Pharmacological action? Type Actions Details Alprostadil approved, investigational yes target agonist Details Dinoprostone approved yes target agonist Details Misoprostol approved yes target agonist Details Limaprost investigational yes target agonist Details Gemeprost approved, withdrawn unknown target agonist Details Treprostinil approved, investigational yes target agonist Details Omidenepag isopropyl approved, investigational yes target agonist Details Prostaglandin D2 investigational yes target agonist Details Dinoprost approved, investigational yes target agonist Details PF-04418948 investigational yes target antagonist Details Evatanepag investigational yes target agonist Details Taprenepag investigational yes target agonist Details Laropiprant approved, investigational, withdrawn yes target inhibitor Details Iloprost approved, investigational yes target agonist Details Mycophenolate mofetil approved, investigational yes target modulator Details Rivenprost investigational yes target agonist Details Trichostatin A experimental unknown target regulator Details