Gamma-aminobutyric acid receptor subunit beta-2
Details
- Name
- Gamma-aminobutyric acid receptor subunit beta-2
- Synonyms
- GABA(A) receptor subunit beta-2
- GABAAR subunit beta-2
- Gene Name
- GABRB2
- UniProtKB Entry
- P47870Swiss-Prot
- Organism
- Humans
- NCBI Taxonomy ID
- 9606
- Amino acid sequence
>lcl|BSEQ0037195|Gamma-aminobutyric acid receptor subunit beta-2 MWRVRKRGYFGIWSFPLIIAAVCAQSVNDPSNMSLVKETVDRLLKGYDIRLRPDFGGPPV AVGMNIDIASIDMVSEVNMDYTLTMYFQQAWRDKRLSYNVIPLNLTLDNRVADQLWVPDT YFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIES YGYTTDDIEFYWRGDDNAVTGVTKIELPQFSIVDYKLITKKVVFSTGSYPRLSLSFKLKR NIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIP YVKAIDMYLMGCFVFVFMALLEYALVNYIFFGRGPQRQKKAAEKAASANNEKMRLDVNKI FYKDIKQNGTQYRSLWDPTGNLSPTRRTTNYDFSLYTMDPHENILLSTLEIKNEMATSEA VMGLGDPRSTMLAYDASSIQYRKAGLPRHSFGRNALERHVAQKKSRLRRRASQLKITIPD LTDVNAIDRWSRIFFPVVFSFFNIVYWLYYVN
- Number of residues
- 512
- Molecular Weight
- 59149.895
- Theoretical pI
- 9.66
- GO Classification
- FunctionsGABA-gated chloride ion channel activity / neurotransmitter receptor activity / transmitter-gated monoatomic ion channel activity involved in regulation of postsynaptic membrane potentialProcesseschemical synaptic transmission / inhibitory synapse assemblyComponentscytoplasmic vesicle membrane / GABA-ergic synapse / postsynaptic specialization membrane / transmembrane transporter complex
- General Function
- Beta subunit of the heteropentameric ligand-gated chloride channel gated by gamma-aminobutyric acid (GABA), a major inhibitory neurotransmitter in the brain (PubMed:19763268, PubMed:27789573, PubMed:29950725, PubMed:8264558). GABA-gated chloride channels, also named GABA(A) receptors (GABAAR), consist of five subunits arranged around a central pore and contain GABA active binding site(s) located at the alpha and beta subunit interface(s) (PubMed:29950725). When activated by GABA, GABAARs selectively allow the flow of chloride anions across the cell membrane down their electrochemical gradient (By similarity). Chloride influx into the postsynaptic neuron following GABAAR opening decreases the neuron ability to generate a new action potential, thereby reducing nerve transmission (By similarity). GABAARs containing alpha-1 and beta-2 or -3 subunits exhibit synaptogenic activity; the gamma-2 subunit being necessary but not sufficient to induce rapid synaptic contacts formation (PubMed:23909897, PubMed:25489750). Extrasynaptic beta-2 receptors contribute to the tonic GABAergic inhibition (By similarity). Beta-containing GABAARs can simultaneously bind GABA and histamine where histamine binds at the interface of two neighboring beta subunits, which may be involved in the regulation of sleep and wakefulness (By similarity)
- Specific Function
- Chloride channel activity
- Pfam Domain Function
- Signal Regions
- 1-25
- Transmembrane Regions
- 242-262 273-292 311-331 491-511
- Cellular Location
- Postsynaptic cell membrane
- Gene sequence
>lcl|BSEQ0011685|Gamma-aminobutyric acid receptor subunit beta-2 (GABRB2) ATGTGGAGAGTGCGGAAAAGGGGCTACTTTGGGATTTGGTCCTTCCCCTTAATAATCGCC GCTGTCTGTGCGCAGAGTGTCAATGACCCTAGTAATATGTCGCTGGTTAAAGAGACGGTG GATAGACTCCTGAAAGGCTATGACATTCGTCTGAGACCAGATTTTGGAGGTCCCCCCGTG GCTGTGGGGATGAACATTGACATTGCCAGCATCGATATGGTTTCTGAAGTCAATATGGAT TATACCTTGACAATGTACTTTCAACAAGCCTGGAGAGATAAGAGGCTGTCCTATAATGTA ATACCTTTAAACTTGACTCTGGACAACAGAGTGGCAGACCAGCTCTGGGTGCCTGATACC TATTTCCTGAACGATAAGAAGTCATTTGTGCACGGAGTGACTGTTAAGAACCGCATGATT CGCCTGCATCCTGATGGCACCGTCCTTTATGGACTCAGAATCACAACCACAGCTGCCTGC ATGATGGACCTAAGGAGGTACCCACTGGATGAACAAAACTGCACCTTGGAAATTGAGAGC TATGGATACACAACTGATGACATTGAGTTTTACTGGCGTGGCGATGATAATGCAGTAACA GGAGTAACGAAAATTGAACTTCCACAGTTCTCTATTGTAGATTACAAACTTATCACCAAG AAGGTTGTTTTTTCCACAGGTTCCTATCCCAGGTTATCCCTCAGCTTTAAGCTTAAGAGA AACATTGGCTACTTTATCCTGCAAACATACATGCCTTCCATCCTGATTACCATCCTCTCC TGGGTCTCCTTCTGGATTAATTACGATGCTTCAGCTGCAAGGGTGGCATTAGGAATCACA ACTGTCCTCACAATGACCACAATCAACACCCACCTCCGGGAAACTCTCCCTAAAATCCCC TATGTGAAGGCCATTGACATGTACCTGATGGGGTGCTTTGTCTTCGTTTTCATGGCCCTT CTGGAATATGCCCTAGTCAACTACATCTTCTTTGGGAGGGGGCCCCAACGCCAAAAGAAA GCAGCTGAGAAGGCTGCCAGTGCCAACAATGAGAAGATGCGCCTGGATGTCAACAAGATG GACCCCCATGAGAACATCTTACTGAGCACTCTCGAGATAAAAAATGAAATGGCCACATCT GAGGCTGTGATGGGACTTGGAGACCCCAGAAGCACAATGCTAGCCTATGATGCCTCCAGC ATCCAGTATCGGAAAGCTGGGTTGCCCAGGCATAGTTTTGGCCGAAATGCTCTGGAACGA CATGTGGCGCAAAAGAAAAGTCGCCTGAGGAGACGCGCCTCCCAACTGAAAATCACCATC CCTGACTTGACTGATGTGAATGCCATAGATCGGTGGTCCCGCATATTCTTCCCAGTGGTT TTTTCCTTCTTCAACATCGTCTATTGGCTTTATTATGTGAACTAA
- Chromosome Location
- 5
- Locus
- 5q34
- External Identifiers
Resource Link UniProtKB ID P47870 UniProtKB Entry Name GBRB2_HUMAN GenBank Protein ID 455946 GenBank Gene ID S67368 GeneCard ID GABRB2 GenAtlas ID GABRB2 HGNC ID HGNC:4082 PDB ID(s) 6D6T, 6D6U, 6X3S, 6X3T, 6X3U, 6X3V, 6X3W, 6X3X, 6X3Z, 6X40, 7T0W, 7T0Z, 8DD2, 8DD3, 8SGO, 8SI9, 8SID KEGG ID hsa:2561 NCBI Gene ID 2561 - General References
- Hadingham KL, Wingrove PB, Wafford KA, Bain C, Kemp JA, Palmer KJ, Wilson AW, Wilcox AS, Sikela JM, Ragan CI, et al.: Role of the beta subunit in determining the pharmacology of human gamma-aminobutyric acid type A receptors. Mol Pharmacol. 1993 Dec;44(6):1211-8. [Article]
- McKinley DD, Lennon DJ, Carter DB: Cloning, sequence analysis and expression of two forms of mRNA coding for the human beta 2 subunit of the GABAA receptor. Brain Res Mol Brain Res. 1995 Jan;28(1):175-9. [Article]
- Zhao C, Xu Z, Wang F, Chen J, Ng SK, Wong PW, Yu Z, Pun FW, Ren L, Lo WS, Tsang SY, Xue H: Alternative-splicing in the exon-10 region of GABA(A) receptor beta(2) subunit gene: relationships between novel isoforms and psychotic disorders. PLoS One. 2009 Sep 18;4(9):e6977. doi: 10.1371/journal.pone.0006977. [Article]
- Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [Article]
- Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
- Zhao C, Xu Z, Chen J, Yu Z, Tong KL, Lo WS, Pun FW, Ng SK, Tsang SY, Xue H: Two isoforms of GABA(A) receptor beta2 subunit with different electrophysiological properties: Differential expression and genotypical correlations in schizophrenia. Mol Psychiatry. 2006 Dec;11(12):1092-105. Epub 2006 Sep 19. [Article]
- Denis NJ, Vasilescu J, Lambert JP, Smith JC, Figeys D: Tryptic digestion of ubiquitin standards reveals an improved strategy for identifying ubiquitinated proteins by mass spectrometry. Proteomics. 2007 Mar;7(6):868-74. [Article]
Associated Data
- Bio-Entities
Bio-Entity Type Gamma-aminobutyric acid receptor subunit beta-2 (Humans) protein primaryGABA(A) Receptor (Humans) protein - Drug Relations
Drug Drug group Pharmacological action? Type Actions Details Propofol approved, investigational, vet_approved yes target potentiator Details Ginkgo biloba approved, investigational, nutraceutical unknown target negative modulator Details Fludiazepam experimental, illicit yes target potentiator Details Fospropofol approved, illicit, investigational yes target potentiator Details Ethanol approved unknown target Details Carisoprodol approved unknown target modulator Details Eltanolone investigational yes target inhibitor Details gamma-Aminobutyric acid approved, investigational yes target inhibitor Details ZK-93423 investigational yes target inhibitor Details Ethchlorvynol approved, illicit, withdrawn yes target antagonist Details Thiocolchicoside experimental yes target inhibitor Details Brexanolone approved, investigational yes target inhibitor Details Desflurane approved yes target positive allosteric modulator Details Alprazolam approved, illicit, investigational yes target positive allosteric modulator Details Butabarbital approved, illicit yes target positive allosteric modulator Details Chlordiazepoxide approved, illicit, investigational yes target positive allosteric modulator Details Clobazam approved, illicit yes target positive allosteric modulator Details Clonazepam approved, illicit yes target positive allosteric modulator Details Clorazepic acid approved, illicit yes target positive allosteric modulator Details Lorazepam approved yes target positive allosteric modulator Details Ethchlorvynol approved, illicit, withdrawn yes target positive allosteric modulator Details Enflurane approved, investigational, vet_approved yes target potentiator Details Temazepam approved, investigational yes target positive allosteric modulator Details Butalbital approved, illicit yes target positive allosteric modulator Details Etomidate approved yes target positive allosteric modulator Details Talbutal approved, illicit yes target positive allosteric modulator Details Pentobarbital approved, investigational, vet_approved yes target positive allosteric modulator Details Meprobamate approved, illicit yes target positive allosteric modulator Details Eszopiclone approved, investigational yes target positive allosteric modulator Details Metharbital withdrawn yes target positive allosteric modulator Details Isoflurane approved, vet_approved yes target positive allosteric modulator Details Primidone approved, vet_approved yes target positive allosteric modulator Details Halazepam approved, illicit, withdrawn yes target positive allosteric modulator Details Propofol approved, investigational, vet_approved yes target positive allosteric modulator Details Diazepam approved, illicit, investigational, vet_approved yes target positive allosteric modulator Details Oxazepam approved yes target positive allosteric modulator Details Methoxyflurane approved, investigational, vet_approved, withdrawn yes target positive allosteric modulator Details Methyprylon approved, illicit, withdrawn yes target positive allosteric modulator Details Halothane approved, vet_approved yes target positive allosteric modulator Details Flumazenil approved yes target positive allosteric modulator Details Estazolam approved, illicit yes target positive allosteric modulator Details Sevoflurane approved, vet_approved yes target agonist Details Glutethimide approved, illicit yes target positive allosteric modulator Details Prazepam approved, illicit yes target positive allosteric modulator Details Quazepam approved, illicit yes target positive allosteric modulator Details Amoxapine approved unknown target binder Details Prasterone approved, investigational, nutraceutical unknown target antagonist Details Thiocolchicoside experimental yes target antagonist Details Stiripentol approved yes target agonistpositive allosteric modulator Details Taurine approved, nutraceutical yes target agonist Details Lamotrigine approved, investigational unknown target antagonistinducer Details Apalutamide approved, investigational no target antagonist Details Brexanolone approved, investigational yes target positive allosteric modulator Details Memantine approved, investigational unknown target binder Details Medroxyprogesterone acetate approved, investigational unknown target inhibitor Details Phenytoin approved, vet_approved unknown target Details Midazolam approved, illicit yes target positive allosteric modulator Details Flurazepam approved, illicit, investigational yes target positive allosteric modulator Details Triazolam approved, investigational yes target positive allosteric modulator Details Bromazepam approved, illicit, investigational yes target positive allosteric modulator Details Nitrazepam approved yes target positive allosteric modulator Details Camazepam experimental, illicit yes target positive allosteric modulator Details Delorazepam experimental, illicit yes target positive allosteric modulator Details Flunitrazepam approved, illicit yes target positive allosteric modulator Details Etizolam experimental yes target positive allosteric modulator Details Medazepam experimental yes target positive allosteric modulator Details Doxefazepam experimental yes target positive allosteric modulator Details Lormetazepam approved yes target positive allosteric modulator Details Nordazepam experimental yes target positive allosteric modulator Details Adinazolam experimental yes target positive allosteric modulator Details Ethyl loflazepate experimental, illicit yes target positive allosteric modulator Details Cloxazolam experimental yes target positive allosteric modulator Details Clotiazepam approved, illicit yes target positive allosteric modulator Details Ketazolam approved yes target positive allosteric modulator Details Cinolazepam experimental yes target positive allosteric modulator Details Brotizolam investigational, withdrawn yes target positive allosteric modulator Details Pinazepam experimental yes target positive allosteric modulator Details Loprazolam experimental yes target positive allosteric modulator Details Oxazepam acetate experimental yes target positive allosteric modulator Details 1,2-Benzodiazepine approved, investigational unknown target positive allosteric modulator Details Cinazepam experimental yes target positive allosteric modulator Details Bentazepam experimental yes target positive allosteric modulator Details Mexazolam experimental yes target positive allosteric modulator Details Remimazolam approved, investigational yes target positive allosteric modulator Details Ganaxolone approved, investigational yes target positive allosteric modulator Details Zuranolone approved, experimental yes target positive allosteric modulator Details