Gamma-aminobutyric acid receptor subunit beta-2
Details
- Name
- Gamma-aminobutyric acid receptor subunit beta-2
- Synonyms
- GABA(A) receptor subunit beta-2
- Gene Name
- GABRB2
- Organism
- Humans
- Amino acid sequence
>lcl|BSEQ0037195|Gamma-aminobutyric acid receptor subunit beta-2 MWRVRKRGYFGIWSFPLIIAAVCAQSVNDPSNMSLVKETVDRLLKGYDIRLRPDFGGPPV AVGMNIDIASIDMVSEVNMDYTLTMYFQQAWRDKRLSYNVIPLNLTLDNRVADQLWVPDT YFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIES YGYTTDDIEFYWRGDDNAVTGVTKIELPQFSIVDYKLITKKVVFSTGSYPRLSLSFKLKR NIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIP YVKAIDMYLMGCFVFVFMALLEYALVNYIFFGRGPQRQKKAAEKAASANNEKMRLDVNKI FYKDIKQNGTQYRSLWDPTGNLSPTRRTTNYDFSLYTMDPHENILLSTLEIKNEMATSEA VMGLGDPRSTMLAYDASSIQYRKAGLPRHSFGRNALERHVAQKKSRLRRRASQLKITIPD LTDVNAIDRWSRIFFPVVFSFFNIVYWLYYVN
- Number of residues
- 512
- Molecular Weight
- 59149.895
- Theoretical pI
- 9.66
- GO Classification
- Functionschloride channel activity / GABA-A receptor activity / inhibitory extracellular ligand-gated ion channel activityProcessescellular response to histamine / chloride transmembrane transport / cochlea development / gamma-aminobutyric acid signaling pathway / inner ear receptor cell development / innervation / ion transmembrane transport / negative regulation of neuron apoptotic process / neurological system process / regulation of membrane potential / sensory perception of sound / synaptic transmission / synaptic transmission, GABAergic / transmembrane transport / transportComponentscell junction / chloride channel complex / cytosol / extracellular exosome / GABA-A receptor complex / integral component of plasma membrane / neuron projection / plasma membrane / postsynaptic membrane / synapse
- General Function
- Inhibitory extracellular ligand-gated ion channel activity
- Specific Function
- Component of the heteropentameric receptor for GABA, the major inhibitory neurotransmitter in the vertebrate brain. Functions also as histamine receptor and mediates cellular responses to histamine. Functions as receptor for diazepines and various anesthetics, such as pentobarbital; these are bound at a separate allosteric effector binding site. Functions as ligand-gated chloride channel.
- Pfam Domain Function
- Transmembrane Regions
- 245-266 270-292 304-326 490-511
- Cellular Location
- Cell junction
- Gene sequence
>lcl|BSEQ0011685|Gamma-aminobutyric acid receptor subunit beta-2 (GABRB2) ATGTGGAGAGTGCGGAAAAGGGGCTACTTTGGGATTTGGTCCTTCCCCTTAATAATCGCC GCTGTCTGTGCGCAGAGTGTCAATGACCCTAGTAATATGTCGCTGGTTAAAGAGACGGTG GATAGACTCCTGAAAGGCTATGACATTCGTCTGAGACCAGATTTTGGAGGTCCCCCCGTG GCTGTGGGGATGAACATTGACATTGCCAGCATCGATATGGTTTCTGAAGTCAATATGGAT TATACCTTGACAATGTACTTTCAACAAGCCTGGAGAGATAAGAGGCTGTCCTATAATGTA ATACCTTTAAACTTGACTCTGGACAACAGAGTGGCAGACCAGCTCTGGGTGCCTGATACC TATTTCCTGAACGATAAGAAGTCATTTGTGCACGGAGTGACTGTTAAGAACCGCATGATT CGCCTGCATCCTGATGGCACCGTCCTTTATGGACTCAGAATCACAACCACAGCTGCCTGC ATGATGGACCTAAGGAGGTACCCACTGGATGAACAAAACTGCACCTTGGAAATTGAGAGC TATGGATACACAACTGATGACATTGAGTTTTACTGGCGTGGCGATGATAATGCAGTAACA GGAGTAACGAAAATTGAACTTCCACAGTTCTCTATTGTAGATTACAAACTTATCACCAAG AAGGTTGTTTTTTCCACAGGTTCCTATCCCAGGTTATCCCTCAGCTTTAAGCTTAAGAGA AACATTGGCTACTTTATCCTGCAAACATACATGCCTTCCATCCTGATTACCATCCTCTCC TGGGTCTCCTTCTGGATTAATTACGATGCTTCAGCTGCAAGGGTGGCATTAGGAATCACA ACTGTCCTCACAATGACCACAATCAACACCCACCTCCGGGAAACTCTCCCTAAAATCCCC TATGTGAAGGCCATTGACATGTACCTGATGGGGTGCTTTGTCTTCGTTTTCATGGCCCTT CTGGAATATGCCCTAGTCAACTACATCTTCTTTGGGAGGGGGCCCCAACGCCAAAAGAAA GCAGCTGAGAAGGCTGCCAGTGCCAACAATGAGAAGATGCGCCTGGATGTCAACAAGATG GACCCCCATGAGAACATCTTACTGAGCACTCTCGAGATAAAAAATGAAATGGCCACATCT GAGGCTGTGATGGGACTTGGAGACCCCAGAAGCACAATGCTAGCCTATGATGCCTCCAGC ATCCAGTATCGGAAAGCTGGGTTGCCCAGGCATAGTTTTGGCCGAAATGCTCTGGAACGA CATGTGGCGCAAAAGAAAAGTCGCCTGAGGAGACGCGCCTCCCAACTGAAAATCACCATC CCTGACTTGACTGATGTGAATGCCATAGATCGGTGGTCCCGCATATTCTTCCCAGTGGTT TTTTCCTTCTTCAACATCGTCTATTGGCTTTATTATGTGAACTAA
- Chromosome Location
- 5
- Locus
- 5q34
- External Identifiers
Resource Link UniProtKB ID P47870 UniProtKB Entry Name GBRB2_HUMAN GenBank Protein ID 455946 GenBank Gene ID S67368 GenAtlas ID GABRB2 HGNC ID HGNC:4082 - General References
- Hadingham KL, Wingrove PB, Wafford KA, Bain C, Kemp JA, Palmer KJ, Wilson AW, Wilcox AS, Sikela JM, Ragan CI, et al.: Role of the beta subunit in determining the pharmacology of human gamma-aminobutyric acid type A receptors. Mol Pharmacol. 1993 Dec;44(6):1211-8. [PubMed:8264558]
- McKinley DD, Lennon DJ, Carter DB: Cloning, sequence analysis and expression of two forms of mRNA coding for the human beta 2 subunit of the GABAA receptor. Brain Res Mol Brain Res. 1995 Jan;28(1):175-9. [PubMed:7707873]
- Zhao C, Xu Z, Wang F, Chen J, Ng SK, Wong PW, Yu Z, Pun FW, Ren L, Lo WS, Tsang SY, Xue H: Alternative-splicing in the exon-10 region of GABA(A) receptor beta(2) subunit gene: relationships between novel isoforms and psychotic disorders. PLoS One. 2009 Sep 18;4(9):e6977. doi: 10.1371/journal.pone.0006977. [PubMed:19763268]
- Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039]
- Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
- Zhao C, Xu Z, Chen J, Yu Z, Tong KL, Lo WS, Pun FW, Ng SK, Tsang SY, Xue H: Two isoforms of GABA(A) receptor beta2 subunit with different electrophysiological properties: Differential expression and genotypical correlations in schizophrenia. Mol Psychiatry. 2006 Dec;11(12):1092-105. Epub 2006 Sep 19. [PubMed:16983389]
- Denis NJ, Vasilescu J, Lambert JP, Smith JC, Figeys D: Tryptic digestion of ubiquitin standards reveals an improved strategy for identifying ubiquitinated proteins by mass spectrometry. Proteomics. 2007 Mar;7(6):868-74. [PubMed:17370265]
Drug Relations
- Drug Relations
DrugBank ID Name Drug group Pharmacological action? Actions Details DB00818 Propofol approved, investigational, vet_approved yes potentiator Details DB01381 Ginkgo biloba approved, investigational, nutraceutical unknown negative modulator Details DB01567 Fludiazepam experimental, illicit yes potentiator Details DB06716 Fospropofol approved, illicit, investigational yes potentiator Details DB00898 Ethanol approved unknown Details DB00395 Carisoprodol approved unknown modulator Details DB01189 Desflurane approved yes positive allosteric modulator Details DB00404 Alprazolam approved, illicit, investigational yes positive allosteric modulator Details DB00237 Butabarbital approved, illicit yes positive allosteric modulator Details DB00475 Chlordiazepoxide approved, illicit, investigational yes positive allosteric modulator Details DB00349 Clobazam approved, illicit yes positive allosteric modulator Details DB01068 Clonazepam approved, illicit yes positive allosteric modulator Details DB00628 Clorazepic acid approved, illicit yes positive allosteric modulator Details DB00186 Lorazepam approved yes positive allosteric modulator Details DB00189 Ethchlorvynol approved, illicit, withdrawn yes positive allosteric modulator Details DB00228 Enflurane approved, investigational, vet_approved yes potentiator Details DB00231 Temazepam approved, investigational yes positive allosteric modulator Details DB00241 Butalbital approved, illicit yes positive allosteric modulator Details DB00292 Etomidate approved yes positive allosteric modulator Details DB00306 Talbutal approved, illicit yes positive allosteric modulator Details DB00312 Pentobarbital approved, investigational, vet_approved yes positive allosteric modulator Details DB00371 Meprobamate approved, illicit yes positive allosteric modulator Details DB00402 Eszopiclone approved, investigational yes positive allosteric modulator Details DB00463 Metharbital withdrawn yes positive allosteric modulator Details DB00753 Isoflurane approved, vet_approved yes positive allosteric modulator Details DB00794 Primidone approved, vet_approved yes positive allosteric modulator Details DB00801 Halazepam approved, illicit, withdrawn yes positive allosteric modulator Details DB00818 Propofol approved, investigational, vet_approved yes positive allosteric modulator Details DB00829 Diazepam approved, illicit, investigational, vet_approved yes positive allosteric modulator Details DB00842 Oxazepam approved yes positive allosteric modulator Details DB01028 Methoxyflurane approved, investigational, vet_approved yes positive allosteric modulator Details DB01107 Methyprylon approved, illicit, withdrawn yes positive allosteric modulator Details DB01159 Halothane approved, vet_approved yes positive allosteric modulator Details DB01205 Flumazenil approved yes positive allosteric modulator Details DB01215 Estazolam approved, illicit yes positive allosteric modulator Details DB01236 Sevoflurane approved, vet_approved yes positive allosteric modulator Details DB01437 Glutethimide approved, illicit yes positive allosteric modulator Details DB01588 Prazepam approved, illicit yes positive allosteric modulator Details DB01589 Quazepam approved, illicit yes positive allosteric modulator Details DB00543 Amoxapine approved unknown binder Details DB01708 Prasterone approved, investigational, nutraceutical unknown antagonist Details DB11582 Thiocolchicoside experimental yes antagonist Details DB09118 Stiripentol approved yes agonistpositive allosteric modulator Details DB01956 Taurine approved, nutraceutical yes agonist Details DB00555 Lamotrigine approved, investigational unknown antagonistinducer Details DB11901 Apalutamide approved, investigational unknown antagonist Details DB11859 Brexanolone approved, investigational yes positive allosteric modulator Details DB01043 Memantine approved, investigational unknown binder Details DB00603 Medroxyprogesterone acetate approved, investigational unknown inhibitor Details DB00252 Phenytoin approved, vet_approved unknown Details DB00683 Midazolam approved, illicit yes positive allosteric modulator Details DB00690 Flurazepam approved, illicit, investigational yes positive allosteric modulator Details DB00897 Triazolam approved, investigational yes positive allosteric modulator Details DB01558 Bromazepam approved, illicit, investigational yes positive allosteric modulator Details DB01595 Nitrazepam approved yes positive allosteric modulator Details DB01489 Camazepam experimental, illicit yes positive allosteric modulator Details DB01511 Delorazepam experimental, illicit yes positive allosteric modulator Details DB01544 Flunitrazepam approved, illicit yes positive allosteric modulator Details DB09166 Etizolam experimental yes positive allosteric modulator Details DB13437 Medazepam experimental yes positive allosteric modulator Details DB13837 Doxefazepam experimental yes positive allosteric modulator Details DB13872 Lormetazepam approved yes positive allosteric modulator Details DB14028 Nordazepam experimental yes positive allosteric modulator Details DB00546 Adinazolam experimental yes positive allosteric modulator Details DB01545 Ethyl loflazepate experimental, illicit yes positive allosteric modulator Details DB01553 Cloxazolam experimental yes positive allosteric modulator Details DB01559 Clotiazepam approved, illicit yes positive allosteric modulator Details DB01587 Ketazolam approved yes positive allosteric modulator Details DB01594 Cinolazepam experimental yes positive allosteric modulator Details DB09017 Brotizolam investigational, withdrawn yes positive allosteric modulator Details DB13335 Pinazepam experimental yes positive allosteric modulator Details DB13643 Loprazolam experimental yes positive allosteric modulator Details DB14672 Oxazepam acetate experimental yes positive allosteric modulator Details DB12537 Benzodiazepine approved, investigational unknown positive allosteric modulator Details DB14715 Cinazepam experimental yes positive allosteric modulator Details DB14719 Bentazepam experimental yes positive allosteric modulator Details DB15489 Mexazolam experimental yes positive allosteric modulator Details DB12404 Remimazolam approved, investigational yes positive allosteric modulator Details