Transforming growth factor beta-2
Details
- Name
- Transforming growth factor beta-2
- Synonyms
- BSC-1 cell growth inhibitor
- Cetermin
- G-TSF
- Glioblastoma-derived T-cell suppressor factor
- Polyergin
- TGF-beta-2
- Gene Name
- TGFB2
- Organism
- Humans
- Amino acid sequence
>lcl|BSEQ0006753|Transforming growth factor beta-2 MHYCVLSAFLILHLVTVALSLSTCSTLDMDQFMRKRIEAIRGQILSKLKLTSPPEDYPEP EEVPPEVISIYNSTRDLLQEKASRRAAACERERSDEEYYAKEVYKIDMPPFFPSENAIPP TFYRPYFRIVRFDVSAMEKNASNLVKAEFRVFRLQNPKARVPEQRIELYQILKSKDLTSP TQRYIDSKVVKTRAEGEWLSFDVTDAVHEWLHHKDRNLGFKISLHCPCCTFVPSNNYIIP NKSEELEARFAGIDGTSTYTSGDQKTIKSTRKKNSGKTPHLLLMLLPSYRLESQQTNRRK KRALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQH SRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS
- Number of residues
- 414
- Molecular Weight
- 47747.275
- Theoretical pI
- 8.64
- GO Classification
- Functionsbeta-amyloid binding / cytokine activity / protein heterodimerization activity / protein homodimerization activity / receptor binding / receptor signaling protein serine/threonine kinase activity / transforming growth factor beta receptor binding / type II transforming growth factor beta receptor binding / type III transforming growth factor beta receptor bindingProcessesactivation of protein kinase activity / angiogenesis / axon guidance / blood coagulation / blood vessel remodeling / cardiac epithelial to mesenchymal transition / cardiac muscle cell proliferation / cardioblast differentiation / cartilage condensation / catagen / cell cycle arrest / cell death / cell development / cell growth / cell migration / cell morphogenesis / cell proliferation / cell-cell junction organization / cell-cell signaling / collagen fibril organization / dopamine biosynthetic process / embryo development / embryonic digestive tract development / epithelial to mesenchymal transition / extracellular matrix organization / extrinsic apoptotic signaling pathway / eye development / face morphogenesis / generation of neurons / glial cell migration / hair follicle development / hair follicle morphogenesis / heart development / heart morphogenesis / heart valve morphogenesis / hemopoiesis / negative regulation of alkaline phosphatase activity / negative regulation of cartilage development / negative regulation of cell growth / negative regulation of cell proliferation / negative regulation of epithelial cell proliferation / negative regulation of immune response / negative regulation of macrophage cytokine production / neuron development / neuron fate commitment / neutrophil chemotaxis / odontogenesis / pathway-restricted SMAD protein phosphorylation / platelet activation / platelet degranulation / positive regulation of activation-induced cell death of T cells / positive regulation of cardioblast differentiation / positive regulation of catagen / positive regulation of cell adhesion mediated by integrin / positive regulation of cell cycle / positive regulation of cell division / positive regulation of cell growth / positive regulation of cell proliferation / positive regulation of epithelial cell migration / positive regulation of epithelial to mesenchymal transition / positive regulation of extrinsic apoptotic signaling pathway in absence of ligand / positive regulation of gene expression / positive regulation of heart contraction / positive regulation of immune response / positive regulation of integrin biosynthetic process / positive regulation of neuron apoptotic process / positive regulation of ossification / positive regulation of pathway-restricted SMAD protein phosphorylation / positive regulation of phosphatidylinositol 3-kinase signaling / positive regulation of protein secretion / positive regulation of stress-activated MAPK cascade / protein phosphorylation / regulation of extracellular matrix organization / regulation of transforming growth factor beta2 production / response to drug / response to hypoxia / response to progesterone / response to wounding / salivary gland morphogenesis / signal transduction by protein phosphorylation / SMAD protein import into nucleus / SMAD protein signal transduction / somatic stem cell division / transforming growth factor beta receptor signaling pathway / uterine wall breakdown / wound healingComponentsaxon / endosome / extracellular matrix / extracellular region / extracellular space / neuronal cell body / platelet alpha granule lumen
- General Function
- Type iii transforming growth factor beta receptor binding
- Specific Function
- TGF-beta 2 has suppressive effects on interleukin-2 dependent T-cell growth.
- Pfam Domain Function
- Transmembrane Regions
- Not Available
- Cellular Location
- Secreted
- Gene sequence
>lcl|BSEQ0021935|Transforming growth factor beta-2 (TGFB2) ATGCACTACTGTGTGCTGAGCGCTTTTCTGATCCTGCATCTGGTCACGGTCGCGCTCAGC CTGTCTACCTGCAGCACACTCGATATGGACCAGTTCATGCGCAAGAGGATCGAGGCGATC CGCGGGCAGATCCTGAGCAAGCTGAAGCTCACCAGTCCCCCAGAAGACTATCCTGAGCCC GAGGAAGTCCCCCCGGAGGTGATTTCCATCTACAACAGCACCAGGGACTTGCTCCAGGAG AAGGCGAGCCGGAGGGCGGCCGCCTGCGAGCGCGAGAGGAGCGACGAAGAGTACTACGCC AAGGAGGTTTACAAAATAGACATGCCGCCCTTCTTCCCCTCCGAAACTGTCTGCCCAGTT GTTACAACACCCTCTGGCTCAGTGGGCAGCTTGTGCTCCAGACAGTCCCAGGTGCTCTGT GGGTACCTTGATGCCATCCCGCCCACTTTCTACAGACCCTACTTCAGAATTGTTCGATTT GACGTCTCAGCAATGGAGAAGAATGCTTCCAATTTGGTGAAAGCAGAGTTCAGAGTCTTT CGTTTGCAGAACCCAAAAGCCAGAGTGCCTGAACAACGGATTGAGCTATATCAGATTCTC AAGTCCAAAGATTTAACATCTCCAACCCAGCGCTACATCGACAGCAAAGTTGTGAAAACA AGAGCAGAAGGCGAATGGCTCTCCTTCGATGTAACTGATGCTGTTCATGAATGGCTTCAC CATAAAGACAGGAACCTGGGATTTAAAATAAGCTTACACTGTCCCTGCTGCACTTTTGTA CCATCTAATAATTACATCATCCCAAATAAAAGTGAAGAACTAGAAGCAAGATTTGCAGGT ATTGATGGCACCTCCACATATACCAGTGGTGATCAGAAAACTATAAAGTCCACTAGGAAA AAAAACAGTGGGAAGACCCCACATCTCCTGCTAATGTTATTGCCCTCCTACAGACTTGAG TCACAACAGACCAACCGGCGGAAGAAGCGTGCTTTGGATGCGGCCTATTGCTTTAGAAAT GTGCAGGATAATTGCTGCCTACGTCCACTTTACATTGATTTCAAGAGGGATCTAGGGTGG AAATGGATACACGAACCCAAAGGGTACAATGCCAACTTCTGTGCTGGAGCATGCCCGTAT TTATGGAGTTCAGACACTCAGCACAGCAGGGTCCTGAGCTTATATAATACCATAAATCCA GAAGCATCTGCTTCTCCTTGCTGCGTGTCCCAAGATTTAGAACCTCTAACCATTCTCTAC TACATTGGCAAAACACCCAAGATTGAACAGCTTTCTAATATGATTGTAAAGTCTTGCAAA TGCAGCTAA
- Chromosome Location
- 1
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P61812 UniProtKB Entry Name TGFB2_HUMAN GenBank Gene ID M87843 GenAtlas ID TGFB2 HGNC ID HGNC:11768 - General References
- de Martin R, Haendler B, Hofer-Warbinek R, Gaugitsch H, Wrann M, Schlusener H, Seifert JM, Bodmer S, Fontana A, Hofer E: Complementary DNA for human glioblastoma-derived T cell suppressor factor, a novel member of the transforming growth factor-beta gene family. EMBO J. 1987 Dec 1;6(12):3673-7. [Article]
- Madisen L, Webb NR, Rose TM, Marquardt H, Ikeda T, Twardzik D, Seyedin S, Purchio AF: Transforming growth factor-beta 2: cDNA cloning and sequence analysis. DNA. 1988 Jan-Feb;7(1):1-8. [Article]
- Webb NR, Madisen L, Rose TM, Purchio AF: Structural and sequence analysis of TGF-beta 2 cDNA clones predicts two different precursor proteins produced by alternative mRNA splicing. DNA. 1988 Sep;7(7):493-7. [Article]
- Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [Article]
- Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
- Noma T, Glick AB, Geiser AG, O'Reilly MA, Miller J, Roberts AB, Sporn MB: Molecular cloning and structure of the human transforming growth factor-beta 2 gene promoter. Growth Factors. 1991;4(4):247-55. [Article]
- Marquardt H, Lioubin MN, Ikeda T: Complete amino acid sequence of human transforming growth factor type beta 2. J Biol Chem. 1987 Sep 5;262(25):12127-31. [Article]
- David D, Cardoso J, Marques B, Marques R, Silva ED, Santos H, Boavida MG: Molecular characterization of a familial translocation implicates disruption of HDAC9 and possible position effect on TGFbeta2 in the pathogenesis of Peters' anomaly. Genomics. 2003 May;81(5):489-503. [Article]
- Nakajima M, Kizawa H, Saitoh M, Kou I, Miyazono K, Ikegawa S: Mechanisms for asporin function and regulation in articular cartilage. J Biol Chem. 2007 Nov 2;282(44):32185-92. Epub 2007 Sep 7. [Article]
- Daopin S, Piez KA, Ogawa Y, Davies DR: Crystal structure of transforming growth factor-beta 2: an unusual fold for the superfamily. Science. 1992 Jul 17;257(5068):369-73. [Article]
- Schlunegger MP, Grutter MG: An unusual feature revealed by the crystal structure at 2.2 A resolution of human transforming growth factor-beta 2. Nature. 1992 Jul 30;358(6385):430-4. [Article]
- Alansari A, Hajeer AH, Bayat A, Eyre S, Carthy D, Ollier WE: Two novel polymorphisms in the human transforming growth factor beta 2 gene. Genes Immun. 2001 Aug;2(5):295-6. [Article]
- Lindsay ME, Schepers D, Bolar NA, Doyle JJ, Gallo E, Fert-Bober J, Kempers MJ, Fishman EK, Chen Y, Myers L, Bjeda D, Oswald G, Elias AF, Levy HP, Anderlid BM, Yang MH, Bongers EM, Timmermans J, Braverman AC, Canham N, Mortier GR, Brunner HG, Byers PH, Van Eyk J, Van Laer L, Dietz HC, Loeys BL: Loss-of-function mutations in TGFB2 cause a syndromic presentation of thoracic aortic aneurysm. Nat Genet. 2012 Jul 8;44(8):922-7. doi: 10.1038/ng.2349. [Article]
- Gago-Diaz M, Blanco-Verea A, Teixido-Tura G, Valenzuela I, Del Campo M, Borregan M, Sobrino B, Amigo J, Garcia-Dorado D, Evangelista A, Carracedo A, Brion M: Whole exome sequencing for the identification of a new mutation in TGFB2 involved in a familial case of non-syndromic aortic disease. Clin Chim Acta. 2014 Nov 1;437:88-92. doi: 10.1016/j.cca.2014.07.016. Epub 2014 Jul 19. [Article]