Ubiquitin-60S ribosomal protein L40

Details

Name
Ubiquitin-60S ribosomal protein L40
Synonyms
Not Available
Gene Name
Not Available
Organism
Plasmodium falciparum (isolate 3D7)
Amino acid sequence
>lcl|BSEQ0051504|Ubiquitin-60S ribosomal protein L40
MQIFVKTLTGKTITLDVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGAIEPSLAQLAQKYNCQKLICRKCYARLHPRATNCRNKKCGRTNQ
LRPKKKLK
Number of residues
128
Molecular Weight
14616.985
Theoretical pI
Not Available
GO Classification
Functions
metal ion binding / protein tag / structural constituent of ribosome
Processes
cellular protein modification process / translation / ubiquitin-dependent protein catabolic process
Components
cytosolic large ribosomal subunit
General Function
Not Available
Specific Function
Metal ion binding
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Gene sequence
>lcl|BSEQ0051505|Ubiquitin-60S ribosomal protein L40
ATGCAAATTTTTGTAAAAACATTAACTGGAAAAACAATTACCCTTGATGTTGAGCCATCT
GATACGATTGAGAATGTTAAGGCAAAAATTCAAGATAAAGAAGGAATTCCTCCTGATCAA
CAAAGATTAATATTTGCTGGAAAACAATTAGAAGATGGAAGGACCTTATCAGATTATAAT
ATTCAAAAGGAATCAACTTTACACTTGGTTTTAAGATTAAGAGGAGGAGCCATAGAACCA
TCCTTAGCACAACTAGCTCAAAAATACAATTGCCAAAAATTAATTTGTAGAAAATGTTAT
GCTAGATTACACCCAAGAGCTACCAACTGCAGAAATAAAAAATGTGGAAGAACCAATCAA
CTAAGACCAAAGAAAAAACTCAAATGA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ8ID50
UniProtKB Entry NameQ8ID50_PLAF7
General References
  1. Gardner MJ, Hall N, Fung E, White O, Berriman M, Hyman RW, Carlton JM, Pain A, Nelson KE, Bowman S, Paulsen IT, James K, Eisen JA, Rutherford K, Salzberg SL, Craig A, Kyes S, Chan MS, Nene V, Shallom SJ, Suh B, Peterson J, Angiuoli S, Pertea M, Allen J, Selengut J, Haft D, Mather MW, Vaidya AB, Martin DM, Fairlamb AH, Fraunholz MJ, Roos DS, Ralph SA, McFadden GI, Cummings LM, Subramanian GM, Mungall C, Venter JC, Carucci DJ, Hoffman SL, Newbold C, Davis RW, Fraser CM, Barrell B: Genome sequence of the human malaria parasite Plasmodium falciparum. Nature. 2002 Oct 3;419(6906):498-511. [Article]
  2. Hall N, Pain A, Berriman M, Churcher C, Harris B, Harris D, Mungall K, Bowman S, Atkin R, Baker S, Barron A, Brooks K, Buckee CO, Burrows C, Cherevach I, Chillingworth C, Chillingworth T, Christodoulou Z, Clark L, Clark R, Corton C, Cronin A, Davies R, Davis P, Dear P, Dearden F, Doggett J, Feltwell T, Goble A, Goodhead I, Gwilliam R, Hamlin N, Hance Z, Harper D, Hauser H, Hornsby T, Holroyd S, Horrocks P, Humphray S, Jagels K, James KD, Johnson D, Kerhornou A, Knights A, Konfortov B, Kyes S, Larke N, Lawson D, Lennard N, Line A, Maddison M, McLean J, Mooney P, Moule S, Murphy L, Oliver K, Ormond D, Price C, Quail MA, Rabbinowitsch E, Rajandream MA, Rutter S, Rutherford KM, Sanders M, Simmonds M, Seeger K, Sharp S, Smith R, Squares R, Squares S, Stevens K, Taylor K, Tivey A, Unwin L, Whitehead S, Woodward J, Sulston JE, Craig A, Newbold C, Barrell BG: Sequence of Plasmodium falciparum chromosomes 1, 3-9 and 13. Nature. 2002 Oct 3;419(6906):527-31. [Article]
  3. Wong W, Bai XC, Brown A, Fernandez IS, Hanssen E, Condron M, Tan YH, Baum J, Scheres SH: Cryo-EM structure of the Plasmodium falciparum 80S ribosome bound to the anti-protozoan drug emetine. Elife. 2014 Jun 9;3. doi: 10.7554/eLife.03080. [Article]
  4. Sun M, Li W, Blomqvist K, Das S, Hashem Y, Dvorin JD, Frank J: Dynamical features of the Plasmodium falciparum ribosome during translation. Nucleic Acids Res. 2015 Dec 2;43(21):10515-24. doi: 10.1093/nar/gkv991. Epub 2015 Oct 1. [Article]
  5. Wong W, Bai XC, Sleebs BE, Triglia T, Brown A, Thompson JK, Jackson KE, Hanssen E, Marapana DS, Fernandez IS, Ralph SA, Cowman AF, Scheres SHW, Baum J: Mefloquine targets the Plasmodium falciparum 80S ribosome to inhibit protein synthesis. Nat Microbiol. 2017 Mar 13;2:17031. doi: 10.1038/nmicrobiol.2017.31. [Article]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB11638Artenimolapproved, experimental, investigationalunknownligandDetails