Potassium voltage-gated channel subfamily A member 7

Details

Name
Potassium voltage-gated channel subfamily A member 7
Synonyms
  • Voltage-gated potassium channel subunit Kv1.7
Gene Name
KCNA7
Organism
Humans
Amino acid sequence
>lcl|BSEQ0019624|Potassium voltage-gated channel subfamily A member 7
MEPRCPPPCGCCERLVLNVAGLRFETRARTLGRFPDTLLGDPARRGRFYDDARREYFFDR
HRPSFDAVLYYYQSGGRLRRPAHVPLDVFLEEVAFYGLGAAALARLREDEGCPVPPERPL
PRRAFARQLWLLFEFPESSQAARVLAVVSVLVILVSIVVFCLETLPDFRDDRDGTGLAAA
AAAGPFPAPLNGSSQMPGNPPRLPFNDPFFVVETLCICWFSFELLVRLLVCPSKAIFFKN
VMNLIDFVAILPYFVALGTELARQRGVGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQI
LGQTLRASMRELGLLIFFLFIGVVLFSSAVYFAEVDRVDSHFTSIPESFWWAVVTMTTVG
YGDMAPVTVGGKIVGSLCAIAGVLTISLPVPVIVSNFSYFYHRETEGEEAGMFSHVDMQP
CGPLEGKANGGLVDGEVPELPPPLWAPPGKHLVTEV
Number of residues
456
Molecular Weight
50558.415
Theoretical pI
Not Available
GO Classification
Functions
delayed rectifier potassium channel activity
Processes
potassium ion transmembrane transport / protein homooligomerization / synaptic transmission
Components
integral component of membrane / plasma membrane / voltage-gated potassium channel complex
General Function
Delayed rectifier potassium channel activity
Specific Function
Mediates the voltage-dependent potassium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a potassium-selective channel through which potassium ions may pass in accordance with their electrochemical gradient (By similarity).
Pfam Domain Function
Transmembrane Regions
144-164 209-229 241-261 276-295 312-332 373-393
Cellular Location
Membrane
Gene sequence
>lcl|BSEQ0019625|Potassium voltage-gated channel subfamily A member 7 (KCNA7)
ATGGAGCCGCGGTGCCCGCCGCCGTGCGGCTGCTGCGAGCGGCTGGTGCTCAACGTGGCC
GGGCTGCGCTTCGAGACGCGGGCGCGCACGCTGGGCCGCTTCCCGGACACTCTGCTAGGG
GACCCAGCGCGCCGCGGCCGCTTCTACGACGACGCGCGCCGCGAGTATTTCTTCGACCGG
CACCGGCCCAGCTTCGACGCCGTGCTCTACTACTACCAGTCCGGTGGGCGGCTGCGGCGG
CCGGCGCACGTGCCGCTCGACGTCTTCCTGGAAGAGGTGGCCTTCTACGGGCTGGGCGCG
GCGGCCCTGGCACGCCTGCGCGAGGACGAGGGCTGCCCGGTGCCGCCCGAGCGCCCCCTG
CCCCGCCGCGCCTTCGCCCGCCAGCTGTGGCTGCTTTTCGAGTTTCCCGAGAGCTCTCAG
GCCGCGCGCGTGCTCGCCGTAGTCTCCGTGCTGGTCATCCTCGTCTCCATCGTCGTCTTC
TGCCTCGAGACGCTGCCTGACTTCCGCGACGACCGCGACGGCACGGGGCTTGCTGCTGCA
GCCGCAGCCGGCCCGTTCCCCGCTCCGCTGAATGGCTCCAGCCAAATGCCTGGAAATCCA
CCCCGCCTGCCCTTCAATGACCCGTTCTTCGTGGTGGAGACGCTGTGTATTTGTTGGTTC
TCCTTTGAGCTGCTGGTACGCCTCCTGGTCTGTCCAAGCAAGGCTATCTTCTTCAAGAAC
GTGATGAACCTCATCGATTTTGTGGCTATCCTTCCCTACTTTGTGGCACTGGGCACCGAG
CTGGCCCGGCAGCGAGGGGTGGGCCAGCAGGCCATGTCACTGGCCATCCTGAGAGTCATC
CGATTGGTGCGTGTCTTCCGCATCTTCAAGCTGTCCCGGCACTCAAAGGGCCTGCAAATC
TTGGGCCAGACGCTTCGGGCCTCCATGCGTGAGCTGGGCCTCCTCATCTTTTTCCTCTTC
ATCGGTGTGGTCCTCTTTTCCAGCGCCGTCTACTTTGCCGAAGTTGACCGGGTGGACTCC
CATTTCACTAGCATCCCTGAGTCCTTCTGGTGGGCGGTAGTCACCATGACTACAGTTGGC
TATGGAGACATGGCACCCGTCACTGTGGGTGGCAAGATAGTGGGCTCTCTGTGTGCCATT
GCGGGCGTGCTGACTATTTCCCTGCCAGTGCCCGTCATTGTCTCCAATTTCAGCTACTTT
TATCACCGGGAGACAGAGGGCGAAGAGGCTGGGATGTTCAGCCATGTGGACATGCAGCCT
TGTGGCCCACTGGAGGGCAAGGCCAATGGGGGGCTGGTGGACGGGGAGGTACCTGAGCTA
CCACCTCCACTCTGGGCACCCCCAGGGAAACACCTGGTCACCGAAGTGTGA
Chromosome Location
19
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ96RP8
UniProtKB Entry NameKCNA7_HUMAN
HGNC IDHGNC:6226
General References
  1. Kashuba VI, Kvasha SM, Protopopov AI, Gizatullin RZ, Rynditch AV, Wahlestedt C, Wasserman WW, Zabarovsky ER: Initial isolation and analysis of the human Kv1.7 (KCNA7) gene, a member of the voltage-gated potassium channel gene family. Gene. 2001 May 2;268(1-2):115-22. [PubMed:11368907]
  2. Bardien-Kruger S, Wulff H, Arieff Z, Brink P, Chandy KG, Corfield V: Characterisation of the human voltage-gated potassium channel gene, KCNA7, a candidate gene for inherited cardiac disorders, and its exclusion as cause of progressive familial heart block I (PFHBI). Eur J Hum Genet. 2002 Jan;10(1):36-43. [PubMed:11896454]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB06637DalfampridineapprovedyesantagonistDetails