Neuronal acetylcholine receptor subunit alpha-10

Details

Name
Neuronal acetylcholine receptor subunit alpha-10
Synonyms
  • NACHR alpha-10
  • NACHRA10
  • Nicotinic acetylcholine receptor subunit alpha-10
Gene Name
CHRNA10
Organism
Humans
Amino acid sequence
>lcl|BSEQ0010285|Neuronal acetylcholine receptor subunit alpha-10
MGLRSHHLSLGLLLLFLLPAECLGAEGRLALKLFRDLFANYTSALRPVADTDQTLNVTLE
VTLSQIIDMDERNQVLTLYLWIRQEWTDAYLRWDPNAYGGLDAIRIPSSLVWRPDIVLYN
KADAQPPGSASTNVVLRHDGAVRWDAPAITRSSCRVDVAAFPFDAQHCGLTFGSWTHGGH
QLDVRPRGAAASLADFVENVEWRVLGMPARRRVLTYGCCSEPYPDVTFTLLLRRRAAAYV
CNLLLPCVLISLLAPLAFHLPADSGEKVSLGVTVLLALTVFQLLLAESMPPAESVPLIGK
YYMATMTMVTFSTALTILIMNLHYCGPSVRPVPAWARALLLGHLARGLCVRERGEPCGQS
RPPELSPSPQSPEGGAGPPAGPCHEPRCLCRQEALLHHVATIANTFRSHRAAQRCHEDWK
RLARVMDRFFLAIFFSMALVMSLLVLVQAL
Number of residues
450
Molecular Weight
49704.295
Theoretical pI
7.97
GO Classification
Functions
acetylcholine-activated cation-selective channel activity / calcium channel activity / receptor binding
Processes
cation transmembrane transport / detection of mechanical stimulus involved in sensory perception of sound / inner ear morphogenesis / neurological system process / neuromuscular synaptic transmission / positive regulation of cytosolic calcium ion concentration / regulation of cell proliferation / regulation of membrane potential / response to nicotine / signal transduction / synaptic transmission, cholinergic
Components
acetylcholine-gated channel complex / axon / cell junction / cytosol / membrane / neuron projection / perikaryon / postsynaptic membrane / synapse
General Function
Receptor binding
Specific Function
Ionotropic receptor with a probable role in the modulation of auditory stimuli. Agonist binding may induce an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. The channel is permeable to a range of divalent cations including calcium, the influx of which may activate a potassium current which hyperpolarizes the cell membrane. In the ear, this may lead to a reduction in basilar membrane motion, altering the activity of auditory nerve fibers and reducing the range of dynamic hearing. This may protect against acoustic trauma.
Pfam Domain Function
Transmembrane Regions
238-258 268-288 302-322 429-449
Cellular Location
Cell junction
Gene sequence
>lcl|BSEQ0010286|Neuronal acetylcholine receptor subunit alpha-10 (CHRNA10)
ATGCCGGCGCGGCGGCGCGTGCTCACCTACGGCTGCTGCTCCGAGCCCTACCCCGACGTC
ACCTTCACGCTGCTGCTGCGCCGCCGCGCCGCCGCCTACGTGTGCAACCTGCTGCTGCCC
TGCGTGCTCATCTCGCTGCTTGCGCCGCTCGCCTTCCACCTGCCTGCCGACTCAGGCGAG
AAGGTGTCGCTGGGCGTCACCGTGCTGCTGGCGCTCACCGTCTTCCAGTTGCTGCTGGCC
GAGAGCATGCCACCGGCCGAGAGCGTGCCGCTCATCGGGAAGTACTACATGGCCACTATG
ACCATGGTCACATTCTCAACAGCACTCACCATCCTTATCATGAACCTGCATTACTGTGGT
CCCAGTGTCCGCCCAGTGCCAGCCTGGGCTAGGGCCCTCCTGCTGGGACACCTGGCACGG
GGCCTGTGCGTGCGGGAAAGAGGGGAGCCCTGTGGGCAGTCCAGGCCACCTGAGTTATCT
CCTAGCCCCCAGTCGCCTGAAGGAGGGGCTGGCCCCCCAGCGGGCCCTTGCCACGAGCCA
CGATGTCTGTGCCGCCAGGAAGCCCTACTGCACCACGTAGCCACCATTGCCAATACCTTC
CGCAGCCACCGAGCTGCCCAGCGCTGCCATGAGGACTGGAAGCGCCTGGCCCGTGTGATG
GACCGCTTCTTCCTGGCCATCTTCTTCTCCATGGCCCTGGTCATGAGCCTCCTGGTGCTG
GTGCAGGCCCTGTGA
Chromosome Location
11
Locus
11p15.5
External Identifiers
ResourceLink
UniProtKB IDQ9GZZ6
UniProtKB Entry NameACH10_HUMAN
GenBank Protein ID12053839
GenBank Gene IDAJ278118
GenAtlas IDCHRNA10
HGNC IDHGNC:13800
General References
  1. Sgard F, Charpantier E, Bertrand S, Walker N, Caput D, Graham D, Bertrand D, Besnard F: A novel human nicotinic receptor subunit, alpha10, that confers functionality to the alpha9-subunit. Mol Pharmacol. 2002 Jan;61(1):150-9. [Article]
  2. Lustig LR, Peng H, Hiel H, Yamamoto T, Fuchs PA: Molecular cloning and mapping of the human nicotinic acetylcholine receptor alpha10 (CHRNA10). Genomics. 2001 May 1;73(3):272-83. [Article]
  3. Peng H, Ferris RL, Matthews T, Hiel H, Lopez-Albaitero A, Lustig LR: Characterization of the human nicotinic acetylcholine receptor subunit alpha (alpha) 9 (CHRNA9) and alpha (alpha) 10 (CHRNA10) in lymphocytes. Life Sci. 2004 Dec 3;76(3):263-80. [Article]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB01090PentoliniumapprovedyesantagonistDetails
DB01116Trimethaphanapproved, investigationalyesantagonistDetails
DB00184NicotineapprovedunknownagonistDetails
DB05069ATG003investigationalunknownDetails
DB05137LobelineinvestigationalunknownDetails
DB05740RPI-78MinvestigationalunknownDetails
DB00898EthanolapprovedunknownDetails
DB14783Diroximel fumarateapproved, investigationalunknownagonistDetails
DB00237Butabarbitalapproved, illicitunknowninhibitorDetails
DB00202SuccinylcholineapprovedyesagonistDetails