Interleukin-23 subunit alpha
Details
- Name
- Interleukin-23 subunit alpha
- Synonyms
- IL-23 subunit alpha
- IL-23p19
- Interleukin-23 subunit p19
- SGRF
- Gene Name
- IL23A
- Organism
- Humans
- Amino acid sequence
>lcl|BSEQ0020688|Interleukin-23 subunit alpha MLGSRAVMLLLLLPWTAQGRAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEG DEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSP VGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVF AHGAATLSP
- Number of residues
- 189
- Molecular Weight
- 20729.56
- Theoretical pI
- 6.5
- GO Classification
- Processesdefense response to Gram-negative bacterium / defense response to virus / inflammatory response / innate immune response / negative regulation of interleukin-10 production / positive regulation of activated T cell proliferation / positive regulation of activation of JAK2 kinase activity / positive regulation of defense response to virus by host / positive regulation of granulocyte macrophage colony-stimulating factor production / positive regulation of inflammatory response / positive regulation of interferon-gamma production / positive regulation of interleukin-10 production / positive regulation of interleukin-12 production / positive regulation of interleukin-17 production / positive regulation of memory T cell differentiation / positive regulation of natural killer cell activation / positive regulation of natural killer cell proliferation / positive regulation of neutrophil chemotaxis / positive regulation of NF-kappaB import into nucleus / positive regulation of NK T cell activation / positive regulation of NK T cell proliferation / positive regulation of osteoclast differentiation / positive regulation of T cell mediated cytotoxicity / positive regulation of T cell proliferation / positive regulation of T-helper 1 type immune response / positive regulation of T-helper 17 cell lineage commitment / positive regulation of T-helper 17 type immune response / positive regulation of tissue remodeling / positive regulation of transcription from RNA polymerase II promoter / positive regulation of tumor necrosis factor production / positive regulation of tyrosine phosphorylation of Stat3 protein / positive regulation of tyrosine phosphorylation of Stat4 protein / positive regulation of tyrosine phosphorylation of Stat5 protein / regulation of tyrosine phosphorylation of Stat1 protein / T cell proliferation / tissue remodelingComponentsinterleukin-23 complex
- General Function
- Not Available
- Specific Function
- Associates with IL12B to form the IL-23 interleukin, a heterodimeric cytokine which functions in innate and adaptive immunity. IL-23 may constitute with IL-17 an acute response to infection in peripheral tissues. IL-23 binds to a heterodimeric receptor complex composed of IL12RB1 and IL23R, activates the Jak-Stat signaling cascade, stimulates memory rather than naive T-cells and promotes production of proinflammatory cytokines. IL-23 induces autoimmune inflammation and thus may be responsible for autoimmune inflammatory diseases and may be important for tumorigenesis.
- Pfam Domain Function
- IL23 (PF16649)
- Transmembrane Regions
- Not Available
- Cellular Location
- Secreted
- Gene sequence
>lcl|BSEQ0020689|Interleukin-23 subunit alpha (IL23A) ATGCTGGGGAGCAGAGCTGTAATGCTGCTGTTGCTGCTGCCCTGGACAGCTCAGGGCAGA GCTGTGCCTGGGGGCAGCAGCCCTGCCTGGACTCAGTGCCAGCAGCTTTCACAGAAGCTC TGCACACTGGCCTGGAGTGCACATCCACTAGTGGGACACATGGATCTAAGAGAAGAGGGA GATGAAGAGACTACAAATGATGTTCCCCATATCCAGTGTGGAGATGGCTGTGACCCCCAA GGACTCAGGGACAACAGTCAGTTCTGCTTGCAAAGGATCCACCAGGGTCTGATTTTTTAT GAGAAGCTGCTAGGATCGGATATTTTCACAGGGGAGCCTTCTCTGCTCCCTGATAGCCCT GTGGGCCAGCTTCATGCCTCCCTACTGGGCCTCAGCCAACTCCTGCAGCCTGAGGGTCAC CACTGGGAGACTCAGCAGATTCCAAGCCTCAGTCCCAGCCAGCCATGGCAGCGTCTCCTT CTCCGCTTCAAAATCCTTCGCAGCCTCCAGGCCTTTGTGGCTGTAGCCGCCCGGGTCTTT GCCCATGGAGCAGCAACCCTGAGTCCCTAA
- Chromosome Location
- 12
- Locus
- 12q13.2
- External Identifiers
Resource Link UniProtKB ID Q9NPF7 UniProtKB Entry Name IL23A_HUMAN GenBank Gene ID AF301620 GenAtlas ID IL23A HGNC ID HGNC:15488 - General References
- Oppmann B, Lesley R, Blom B, Timans JC, Xu Y, Hunte B, Vega F, Yu N, Wang J, Singh K, Zonin F, Vaisberg E, Churakova T, Liu M, Gorman D, Wagner J, Zurawski S, Liu Y, Abrams JS, Moore KW, Rennick D, de Waal-Malefyt R, Hannum C, Bazan JF, Kastelein RA: Novel p19 protein engages IL-12p40 to form a cytokine, IL-23, with biological activities similar as well as distinct from IL-12. Immunity. 2000 Nov;13(5):715-25. [Article]
- Clark HF, Gurney AL, Abaya E, Baker K, Baldwin D, Brush J, Chen J, Chow B, Chui C, Crowley C, Currell B, Deuel B, Dowd P, Eaton D, Foster J, Grimaldi C, Gu Q, Hass PE, Heldens S, Huang A, Kim HS, Klimowski L, Jin Y, Johnson S, Lee J, Lewis L, Liao D, Mark M, Robbie E, Sanchez C, Schoenfeld J, Seshagiri S, Simmons L, Singh J, Smith V, Stinson J, Vagts A, Vandlen R, Watanabe C, Wieand D, Woods K, Xie MH, Yansura D, Yi S, Yu G, Yuan J, Zhang M, Zhang Z, Goddard A, Wood WI, Godowski P, Gray A: The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment. Genome Res. 2003 Oct;13(10):2265-70. Epub 2003 Sep 15. [Article]
- Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
- Parham C, Chirica M, Timans J, Vaisberg E, Travis M, Cheung J, Pflanz S, Zhang R, Singh KP, Vega F, To W, Wagner J, O'Farrell AM, McClanahan T, Zurawski S, Hannum C, Gorman D, Rennick DM, Kastelein RA, de Waal Malefyt R, Moore KW: A receptor for the heterodimeric cytokine IL-23 is composed of IL-12Rbeta1 and a novel cytokine receptor subunit, IL-23R. J Immunol. 2002 Jun 1;168(11):5699-708. [Article]
- Pirhonen J, Matikainen S, Julkunen I: Regulation of virus-induced IL-12 and IL-23 expression in human macrophages. J Immunol. 2002 Nov 15;169(10):5673-8. [Article]
- Smits HH, van Beelen AJ, Hessle C, Westland R, de Jong E, Soeteman E, Wold A, Wierenga EA, Kapsenberg ML: Commensal Gram-negative bacteria prime human dendritic cells for enhanced IL-23 and IL-27 expression and enhanced Th1 development. Eur J Immunol. 2004 May;34(5):1371-80. [Article]
- Schnurr M, Toy T, Shin A, Wagner M, Cebon J, Maraskovsky E: Extracellular nucleotide signaling by P2 receptors inhibits IL-12 and enhances IL-23 expression in human dendritic cells: a novel role for the cAMP pathway. Blood. 2005 Feb 15;105(4):1582-9. Epub 2004 Oct 14. [Article]
- Fedele G, Stefanelli P, Spensieri F, Fazio C, Mastrantonio P, Ausiello CM: Bordetella pertussis-infected human monocyte-derived dendritic cells undergo maturation and induce Th1 polarization and interleukin-23 expression. Infect Immun. 2005 Mar;73(3):1590-7. [Article]
- Vanden Eijnden S, Goriely S, De Wit D, Goldman M, Willems F: Preferential production of the IL-12(p40)/IL-23(p19) heterodimer by dendritic cells from human newborns. Eur J Immunol. 2006 Jan;36(1):21-6. [Article]
- Piskin G, Sylva-Steenland RM, Bos JD, Teunissen MB: In vitro and in situ expression of IL-23 by keratinocytes in healthy skin and psoriasis lesions: enhanced expression in psoriatic skin. J Immunol. 2006 Feb 1;176(3):1908-15. [Article]
- Vaknin-Dembinsky A, Balashov K, Weiner HL: IL-23 is increased in dendritic cells in multiple sclerosis and down-regulation of IL-23 by antisense oligos increases dendritic cell IL-10 production. J Immunol. 2006 Jun 15;176(12):7768-74. [Article]
- Langowski JL, Zhang X, Wu L, Mattson JD, Chen T, Smith K, Basham B, McClanahan T, Kastelein RA, Oft M: IL-23 promotes tumour incidence and growth. Nature. 2006 Jul 27;442(7101):461-5. Epub 2006 May 10. [Article]
- Lupardus PJ, Garcia KC: The structure of interleukin-23 reveals the molecular basis of p40 subunit sharing with interleukin-12. J Mol Biol. 2008 Oct 17;382(4):931-41. doi: 10.1016/j.jmb.2008.07.051. Epub 2008 Jul 25. [Article]
Drug Relations
- Drug Relations
DrugBank ID Name Drug group Pharmacological action? Actions Details DB05459 Briakinumab investigational unknown Details DB11834 Guselkumab approved, investigational yes blocker Details DB14910 Mirikizumab approved, investigational yes binderantibody Details DB05679 Ustekinumab approved, investigational yes inhibitor Details DB14004 Tildrakizumab approved, investigational yes antagonist Details DB14762 Risankizumab approved, investigational yes inhibitor Details