Acid-sensing ion channel 3

Details

Name
Acid-sensing ion channel 3
Synonyms
  • ACCN3
  • Amiloride-sensitive cation channel 3
  • ASIC3
  • hTNaC1
  • Neuronal amiloride-sensitive cation channel 3
  • SLNAC1
  • Testis sodium channel 1
  • TNAC1
Gene Name
ASIC3
Organism
Humans
Amino acid sequence
>lcl|BSEQ0008617|Acid-sensing ion channel 3
MKPTSGPEEARRPASDIRVFASNCSMHGLGHVFGPGSLSLRRGMWAAAVVLSVATFLYQV
AERVRYYREFHHQTALDERESHRLIFPAVTLCNINPLRRSRLTPNDLHWAGSALLGLDPA
EHAAFLRALGRPPAPPGFMPSPTFDMAQLYARAGHSLDDMLLDCRFRGQPCGPENFTTIF
TRMGKCYTFNSGADGAELLTTTRGGMGNGLDIMLDVQQEEYLPVWRDNEETPFEVGIRVQ
IHSQEEPPIIDQLGLGVSPGYQTFVSCQQQQLSFLPPPWGDCSSASLNPNYEPEPSDPLG
SPSPSPSPPYTLMGCRLACETRYVARKCGCRMVYMPGDVPVCSPQQYKNCAHPAIDAMLR
KDSCACPNPCASTRYAKELSMVRIPSRAAARFLARKLNRSEAYIAENVLALDIFFEALNY
ETVEQKKAYEMSELLGDIGGQMGLFIGASLLTILEILDYLCEVFRDKVLGYFWNRQHSQR
HSSTNLLQEGLGSHRTQVPHLSLGPRPPTPPCAVTKTLSASHRTCYLVTQL
Number of residues
531
Molecular Weight
58904.72
Theoretical pI
Not Available
GO Classification
Functions
cation channel activity / ligand-gated sodium channel activity / sodium channel activity
Processes
cation transmembrane transport / ion transmembrane transport / sensory perception / sensory perception of sour taste / signal transduction / sodium ion transmembrane transport / transmembrane transport / transport
Components
cytoplasm / integral component of plasma membrane / plasma membrane
General Function
Sodium channel activity
Specific Function
Cation channel with high affinity for sodium, which is gated by extracellular protons and inhibited by the diuretic amiloride. Generates a biphasic current with a fast inactivating and a slow sustained phase. In sensory neurons is proposed to mediate the pain induced by acidosis that occurs in ischemic, damaged or inflamed tissue. May be involved in hyperalgesia. May play a role in mechanoreception. Heteromeric channel assembly seems to modulate channel properties.
Pfam Domain Function
Transmembrane Regions
44-61 442-460
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0013307|Acid-sensing ion channel 3 (ASIC3)
ATGAAGCCCACCTCAGGCCCAGAGGAGGCCCGGCGGCCAGCCTCGGACATCCGCGTGTTC
GCCAGCAACTGCTCGATGCACGGGCTGGGCCACGTCTTCGGGCCAGGCAGCCTGAGCCTG
CGCCGGGGGATGTGGGCAGCGGCCGTGGTCCTGTCAGTGGCCACCTTCCTCTACCAGGTG
GCTGAGAGGGTGCGCTACTACAGGGAGTTCCACCACCAGACTGCCCTGGATGAGCGAGAA
AGCCACCGGCTCATCTTCCCGGCTGTCACCCTGTGCAACATCAACCCACTGCGCCGCTCG
CGCCTAACGCCCAACGACCTGCACTGGGCTGGGTCTGCGCTGCTGGGCCTGGATCCCGCA
GAGCACGCCGCCTTCCTGCGCGCCCTGGGCCGGCCCCCTGCACCGCCCGGCTTCATGCCC
AGTCCCACCTTTGACATGGCGCAACTCTATGCCCGTGCTGGGCACTCCCTGGATGACATG
CTGCTGGACTGTCGCTTCCGTGGCCAACCTTGTGGGCCTGAGAACTTCACCACGATCTTC
ACCCGGATGGGAAAGTGCTACACATTTAACTCTGGCGCTGATGGGGCAGAGCTGCTCACC
ACTACTAGGGGTGGCATGGGCAATGGGCTGGACATCATGCTGGACGTGCAGCAGGAGGAA
TATCTACCTGTGTGGAGGGACAATGAGGAGACCCCGTTTGAGGTGGGGATCCGAGTGCAG
ATCCACAGCCAGGAGGAGCCGCCCATCATCGATCAGCTGGGCTTGGGGGTGTCCCCGGGC
TACCAGACCTTTGTTTCTTGCCAGCAGCAGCAGCTGAGCTTCCTGCCACCGCCCTGGGGC
GATTGCAGTTCAGCATCTCTGAACCCCAACTATGAGCCAGAGCCCTCTGATCCCCTAGGC
TCCCCCAGCCCCAGCCCCAGCCCTCCCTATACCCTTATGGGGTGTCGCCTGGCCTGCGAA
ACCCGCTACGTGGCTCGGAAGTGCGGCTGCCGAATGGTGTACATGCCAGGCGACGTGCCA
GTGTGCAGCCCCCAGCAGTACAAGAACTGTGCCCACCCGGCCATAGATGCCATGCTTCGC
AAGGACTCGTGCGCCTGCCCCAACCCGTGCGCCAGCACGCGCTACGCCAAGGAGCTCTCC
ATGGTGCGGATCCCGAGCCGCGCCGCCGCGCGCTTCCTGGCCCGGAAGCTCAACCGCAGC
GAGGCCTACATCGCGGAGAACGTGCTGGCCCTGGACATCTTCTTTGAGGCCCTCAACTAT
GAGACCGTGGAGCAGAAGAAGGCCTATGAGATGTCAGAGCTGCTTGGTGACATTGGGGGC
CAGATGGGGCTGTTCATCGGGGCCAGCCTGCTCACCATCCTCGAGATCCTAGACTACCTC
TGTGAGGTGTTCCGAGACAAGGTCCTGGGATATTTCTGGAACCGACAGCACTCCCAAAGG
CACTCCAGCACCAATCTGCTTCAGGAAGGGCTGGGCAGCCATCGAACCCAAGTTCCCCAC
CTCAGCCTGGGCCCCAGACCTCCCACCCCTCCCTGTGCCGTCACCAAGACTCTCTCCGCC
TCCCACCGCACCTGCTACCTTGTCACACAGCTCTAG
Chromosome Location
7
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ9UHC3
UniProtKB Entry NameASIC3_HUMAN
HGNC IDHGNC:101
General References
  1. Ishibashi K, Marumo F: Molecular cloning of a DEG/ENaC sodium channel cDNA from human testis. Biochem Biophys Res Commun. 1998 Apr 17;245(2):589-93. [PubMed:9571199]
  2. de Weille JR, Bassilana F, Lazdunski M, Waldmann R: Identification, functional expression and chromosomal localisation of a sustained human proton-gated cation channel. FEBS Lett. 1998 Aug 21;433(3):257-60. [PubMed:9744806]
  3. Babinski K, Le KT, Seguela P: Molecular cloning and regional distribution of a human proton receptor subunit with biphasic functional properties. J Neurochem. 1999 Jan;72(1):51-7. [PubMed:9886053]
  4. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039]
  5. Babinski K, Catarsi S, Biagini G, Seguela P: Mammalian ASIC2a and ASIC3 subunits co-assemble into heteromeric proton-gated channels sensitive to Gd3+. J Biol Chem. 2000 Sep 15;275(37):28519-25. [PubMed:10842183]
  6. Catarsi S, Babinski K, Seguela P: Selective modulation of heteromeric ASIC proton-gated channels by neuropeptide FF. Neuropharmacology. 2001 Oct;41(5):592-600. [PubMed:11587714]
  7. Leonard AS, Yermolaieva O, Hruska-Hageman A, Askwith CC, Price MP, Wemmie JA, Welsh MJ: cAMP-dependent protein kinase phosphorylation of the acid-sensing ion channel-1 regulates its binding to the protein interacting with C-kinase-1. Proc Natl Acad Sci U S A. 2003 Feb 18;100(4):2029-34. Epub 2003 Feb 10. [PubMed:12578970]
  8. Hruska-Hageman AM, Benson CJ, Leonard AS, Price MP, Welsh MJ: PSD-95 and Lin-7b interact with acid-sensing ion channel-3 and have opposite effects on H+- gated current. J Biol Chem. 2004 Nov 5;279(45):46962-8. Epub 2004 Aug 17. [PubMed:15317815]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB08838AgmatineexperimentalyesagonistDetails