Thromboxane A2 receptor
Details
- Name
- Thromboxane A2 receptor
- Kind
- protein
- Synonyms
- Prostanoid TP receptor
- TXA2-R
- Gene Name
- TBXA2R
- UniProtKB Entry
- P21731Swiss-Prot
- Organism
- Humans
- NCBI Taxonomy ID
- 9606
- Amino acid sequence
>lcl|BSEQ0037068|Thromboxane A2 receptor MWPNGSSLGPCFRPTNITLEERRLIASPWFAASFCVVGLASNLLALSVLAGARQGGSHTR SSFLTFLCGLVLTDFLGLLVTGTIVVSQHAALFEWHAVDPGCRLCRFMGVVMIFFGLSPL LLGAAMASERYLGITRPFSRPAVASQRRAWATVGLVWAAALALGLLPLLGVGRYTVQYPG SWCFLTLGAESGDVAFGLLFSMLGGLSVGLSFLLNTVSVATLCHVYHGQEAAQQRPRDSE VEMMAQLLGIMVVASVCWLPLLVFIAQTVLRNPPAMSPAGQLSRTTEKELLIYLRVATWN QILDPWVYILFRRAVLRRLQPRLSTRPRSLSLQPQLTQRSGLQ
- Number of residues
- 343
- Molecular Weight
- 37430.69
- Theoretical pI
- 10.31
- GO Classification
- Processesadenylate cyclase-activating G protein-coupled receptor signaling pathway / cellular response to lipopolysaccharide / G protein-coupled receptor signaling pathway / negative regulation of cell migration involved in sprouting angiogenesis / positive regulation of blood coagulation / response to ethanol / response to testosterone / response to xenobiotic stimulus / smooth muscle contractionComponentsnuclear speck
- General Function
- Receptor for thromboxane A2 (TXA2), a potent stimulator of platelet aggregation. The activity of this receptor is mediated by a G-protein that activates a phosphatidylinositol-calcium second messenger system. In the kidney, the binding of TXA2 to glomerular TP receptors causes intense vasoconstriction. Activates phospholipase C
- Specific Function
- guanyl-nucleotide exchange factor activity
- Pfam Domain Function
- 7tm_1 (PF00001)
- Signal Regions
- Not Available
- Transmembrane Regions
- 30-52 67-87 107-128 150-172 194-219 247-270 290-311
- Cellular Location
- Cell membrane
- Gene sequence
>lcl|BSEQ0019006|Thromboxane A2 receptor (TBXA2R) ATGTGGCCCAACGGCAGTTCCCTGGGGCCCTGTTTCCGGCCCACAAACATTACCCTGGAG GAGAGACGGCTGATCGCCTCGCCCTGGTTCGCCGCCTCCTTCTGCGTGGTGGGCCTGGCC TCCAACCTGCTGGCCCTGAGCGTGCTGGCGGGCGCGCGGCAGGGGGGTTCGCACACGCGC TCCTCCTTCCTCACCTTCCTCTGCGGCCTCGTCCTCACCGACTTCCTGGGGCTGCTGGTG ACCGGTACCATCGTGGTGTCCCAGCACGCCGCGCTCTTCGAGTGGCACGCCGTGGACCCT GGCTGCCGTCTCTGTCGCTTCATGGGCGTCGTCATGATCTTCTTCGGCCTGTCCCCGCTG CTGCTGGGGGCCGCCATGGCCTCAGAGCGCTACCTGGGTATCACCCGGCCCTTCTCGCGC CCGGCGGTCGCCTCGCAGCGCCGCGCCTGGGCCACCGTGGGGCTGGTGTGGGCGGCCGCG CTGGCGCTGGGCCTGCTGCCCCTGCTGGGCGTGGGTCGCTACACCGTGCAATACCCGGGG TCCTGGTGCTTCCTGACGCTGGGCGCCGAGTCCGGGGACGTGGCCTTCGGGCTGCTCTTC TCCATGCTGGGCGGCCTCTCGGTCGGGCTGTCCTTCCTGCTGAACACGGTCAGCGTGGCC ACCCTGTGCCACGTCTACCACGGGCAGGAGGCGGCCCAGCAGCGTCCCCGGGACTCCGAG GTGGAGATGATGGCTCAGCTCCTGGGGATCATGGTGGTGGCCAGCGTGTGTTGGCTGCCC CTTCTGGTCTTCATCGCCCAGACAGTGCTGCGAAACCCGCCTGCCATGAGCCCCGCCGGG CAGCTGTCCCGCACCACGGAGAAGGAGCTGCTCATCTACTTGCGCGTGGCCACCTGGAAC CAGATCCTGGACCCCTGGGTGTATATCCTGTTCCGCCGCGCCGTGCTCCGGCGTCTCCAG CCTCGCCTCAGCACCCGGCCCAGGTCGCTGTCCCTCCAGCCCCAGCTCACGCAGCGCTCC GGGCTGCAGTAG
- Chromosome Location
- 19
- Locus
- 19p13.3
- External Identifiers
Resource Link UniProtKB ID P21731 UniProtKB Entry Name TA2R_HUMAN GenBank Protein ID 533326 GenBank Gene ID D38081 GeneCard ID TBXA2R GenAtlas ID TBXA2R HGNC ID HGNC:11608 PDB ID(s) 8XJN, 8XJO KEGG ID hsa:6915 IUPHAR/Guide To Pharmacology ID 346 NCBI Gene ID 6915 - General References
- Hirata M, Hayashi Y, Ushikubi F, Yokota Y, Kageyama R, Nakanishi S, Narumiya S: Cloning and expression of cDNA for a human thromboxane A2 receptor. Nature. 1991 Feb 14;349(6310):617-20. [Article]
- Nusing RM, Hirata M, Kakizuka A, Eki T, Ozawa K, Narumiya S: Characterization and chromosomal mapping of the human thromboxane A2 receptor gene. J Biol Chem. 1993 Nov 25;268(33):25253-9. [Article]
- Raychowdhury MK, Yukawa M, Collins LJ, McGrail SH, Kent KC, Ware JA: Alternative splicing produces a divergent cytoplasmic tail in the human endothelial thromboxane A2 receptor. J Biol Chem. 1994 Jul 29;269(30):19256-61. [Article]
- Raychowdhury MK, Yukawa M, Collins LJ, McGrail SH, Kent KC, Ware JA: Alternative splicing produces a divergent cytoplasmic tail in the human endothelial thromboxane A2 receptor. J Biol Chem. 1995 Mar 24;270(12):7011. [Article]
- D'Angelo DD, Davis MG, Ali S, Dorn GW 2nd: Cloning and pharmacologic characterization of a thromboxane A2 receptor from K562 (human chronic myelogenous leukemia) cells. J Pharmacol Exp Ther. 1994 Nov;271(2):1034-41. [Article]
- Grimwood J, Gordon LA, Olsen A, Terry A, Schmutz J, Lamerdin J, Hellsten U, Goodstein D, Couronne O, Tran-Gyamfi M, Aerts A, Altherr M, Ashworth L, Bajorek E, Black S, Branscomb E, Caenepeel S, Carrano A, Caoile C, Chan YM, Christensen M, Cleland CA, Copeland A, Dalin E, Dehal P, Denys M, Detter JC, Escobar J, Flowers D, Fotopulos D, Garcia C, Georgescu AM, Glavina T, Gomez M, Gonzales E, Groza M, Hammon N, Hawkins T, Haydu L, Ho I, Huang W, Israni S, Jett J, Kadner K, Kimball H, Kobayashi A, Larionov V, Leem SH, Lopez F, Lou Y, Lowry S, Malfatti S, Martinez D, McCready P, Medina C, Morgan J, Nelson K, Nolan M, Ovcharenko I, Pitluck S, Pollard M, Popkie AP, Predki P, Quan G, Ramirez L, Rash S, Retterer J, Rodriguez A, Rogers S, Salamov A, Salazar A, She X, Smith D, Slezak T, Solovyev V, Thayer N, Tice H, Tsai M, Ustaszewska A, Vo N, Wagner M, Wheeler J, Wu K, Xie G, Yang J, Dubchak I, Furey TS, DeJong P, Dickson M, Gordon D, Eichler EE, Pennacchio LA, Richardson P, Stubbs L, Rokhsar DS, Myers RM, Rubin EM, Lucas SM: The DNA sequence and biology of human chromosome 19. Nature. 2004 Apr 1;428(6982):529-35. [Article]
- Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
- Hirata T, Ushikubi F, Kakizuka A, Okuma M, Narumiya S: Two thromboxane A2 receptor isoforms in human platelets. Opposite coupling to adenylyl cyclase with different sensitivity to Arg60 to Leu mutation. J Clin Invest. 1996 Feb 15;97(4):949-56. [Article]
- Funk CD, Furci L, Moran N, Fitzgerald GA: Point mutation in the seventh hydrophobic domain of the human thromboxane A2 receptor allows discrimination between agonist and antagonist binding sites. Mol Pharmacol. 1993 Nov;44(5):934-9. [Article]
- Sasaki M, Sukegawa J, Miyosawa K, Yanagisawa T, Ohkubo S, Nakahata N: Low expression of cell-surface thromboxane A2 receptor beta-isoform through the negative regulation of its membrane traffic by proteasomes. Prostaglandins Other Lipid Mediat. 2007 Jun;83(4):237-49. Epub 2006 Dec 27. [Article]
- Parent A, Laroche G, Hamelin E, Parent JL: RACK1 regulates the cell surface expression of the G protein-coupled receptor for thromboxane A(2). Traffic. 2008 Mar;9(3):394-407. Epub 2007 Dec 14. [Article]
- Tokue S, Sasaki M, Nakahata N: Thromboxane A2-induced signal transduction is negatively regulated by KIAA1005 that directly interacts with thromboxane A2 receptor. Prostaglandins Other Lipid Mediat. 2009 Jun;89(1-2):8-15. doi: 10.1016/j.prostaglandins.2009.02.001. Epub 2009 Feb 13. [Article]
- Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M: Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis. Sci Signal. 2010 Jan 12;3(104):ra3. doi: 10.1126/scisignal.2000475. [Article]
- Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. [Article]
- Hirata T, Kakizuka A, Ushikubi F, Fuse I, Okuma M, Narumiya S: Arg60 to Leu mutation of the human thromboxane A2 receptor in a dominantly inherited bleeding disorder. J Clin Invest. 1994 Oct;94(4):1662-7. [Article]
Associated Data
- Drug Relations
Drug Drug group Pharmacological action? Type Actions Details Ridogrel experimental yes target antagonist Details Seratrodast experimental yes target antagonist Details Morniflumate experimental unknown target Details Fluprostenol vet_approved yes target agonist Details Cloprostenol vet_approved yes target agonist Details Dinoprost approved, investigational yes target agonist Details Terbogrel investigational yes target antagonist Details Ifetroban investigational yes target antagonist Details Ramatroban investigational yes target antagonist Details Laropiprant approved, investigational, withdrawn yes target inhibitor Details Alprostadil approved, investigational yes target modulator Details