Immunoglobulin heavy constant epsilon
Details
- Name
- Immunoglobulin heavy constant epsilon
- Kind
- protein
- Synonyms
- Ig epsilon chain C region
- Ig epsilon chain C region ND
- Gene Name
- IGHE
- UniProtKB Entry
- P01854Swiss-Prot
- Organism
- Humans
- NCBI Taxonomy ID
- 9606
- Amino acid sequence
>lcl|BSEQ0055463|Immunoglobulin heavy constant epsilon ASTQSPSVFPLTRCCKNIPSNATSVTLGCLATGYFPEPVMVTWDTGSLNGTTMTLPATTL TLSGHYATISLLTVSGAWAKQMFTCRVAHTPSSTDWVDNKTFSVCSRDFTPPTVKILQSS CDGGGHFPPTIQLLCLVSGYTPGTINITWLEDGQVMDVDLSTASTTQEGELASTQSELTL SQKHWLSDRTYTCQVTYQGHTFEDSTKKCADSNPRGVSAYLSRPSPFDLFIRKSPTITCL VVDLAPSKGTVNLTWSRASGKPVNHSTRKEEKQRNGTLTVTSTLPVGTRDWIEGETYQCR VTHPHLPRALMRSTTKTSGPRAAPEVYAFATPEWPGSRDKRTLACLIQNFMPEDISVQWL HNEVQLPDARHSTTQPRKTKGSGFFVFSRLEVTRAEWEQKDEFICRAVHEAASPSQTVQR AVSVNPGLAGGSAQSQRAPDRVLCHSGQQQGLPRAAGGSVPHPRCHCGAGRADWPGPPEL DVCVEEAEGEAPWTWTGLCIFAALFLLSVSYSAAITLLMVQRFLSATRQGRPQTSLDYTN VLQPHA
- Number of residues
- 546
- Molecular Weight
- 59538.685
- Theoretical pI
- Not Available
- GO Classification
- Processesadaptive immune memory response / adaptive immune response / antibacterial humoral response / antibody-dependent cellular cytotoxicity / B cell antigen processing and presentation / B cell proliferation / eosinophil degranulation / Fc receptor-mediated immune complex endocytosis / inflammatory response / macrophage activation / macrophage differentiation / mast cell degranulation / primary adaptive immune response / type 2 immune response / type I hypersensitivityComponentsextracellular space / IgE B cell receptor complex / IgE immunoglobulin complex / plasma membrane
- General Function
- Constant region of immunoglobulin heavy chains. Immunoglobulins, also known as antibodies, are membrane-bound or secreted glycoproteins produced by B lymphocytes. In the recognition phase of humoral immunity, the membrane-bound immunoglobulins serve as receptors which, upon binding of a specific antigen, trigger the clonal expansion and differentiation of B lymphocytes into immunoglobulins-secreting plasma cells. Secreted immunoglobulins mediate the effector phase of humoral immunity, which results in the elimination of bound antigens (PubMed:20176268, PubMed:22158414). The antigen binding site is formed by the variable domain of one heavy chain, together with that of its associated light chain. Thus, each immunoglobulin has two antigen binding sites with remarkable affinity for a particular antigen. The variable domains are assembled by a process called V-(D)-J rearrangement and can then be subjected to somatic hypermutations which, after exposure to antigen and selection, allow affinity maturation for a particular antigen (PubMed:17576170, PubMed:20176268)
- Specific Function
- Antigen binding
- Pfam Domain Function
- C1-set (PF07654)
- Signal Regions
- Not Available
- Transmembrane Regions
- 500-520
- Cellular Location
- Secreted
- Gene sequence
- Not Available
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P01854 UniProtKB Entry Name IGHE_HUMAN GeneCard ID IGHE HGNC ID HGNC:5522 PDB ID(s) 1F6A, 1FP5, 1G84, 1O0V, 2WQR, 2Y7Q, 3H9Y, 3H9Z, 3HA0, 4EZM, 4GKO, 4GRG, 4GT7, 4J4P, 4KI1, 5ANM, 5HYS, 5LGJ, 5LGK, 5MOI, 5MOJ, 5MOK, 5MOL, 5NQW, 6EYO, 6UQR, 7MXI, 7SHT, 7SHU, 7SHY, 7SHZ, 7SI0, 8C1B, 8C1C IUPHAR/Guide To Pharmacology ID 2741 - General References
- Max EE, Battey J, Ney R, Kirsch IR, Leder P: Duplication and deletion in the human immunoglobulin epsilon genes. Cell. 1982 Jun;29(2):691-9. [Article]
- Flanagan JG, Rabbitts TH: The sequence of a human immunoglobulin epsilon heavy chain constant region gene, and evidence for three non-allelic genes. EMBO J. 1982;1(5):655-60. [Article]
- Ueda S, Nakai S, Nishida Y, Hisajima H, Honjo T: Long terminal repeat-like elements flank a human immunoglobulin epsilon pseudogene that lacks introns. EMBO J. 1982;1(12):1539-44. [Article]
- Seno M, Kurokawa T, Ono Y, Onda H, Sasada R, Igarashi K, Kikuchi M, Sugino Y, Nishida Y, Honjo T: Molecular cloning and nucleotide sequencing of human immunoglobulin epsilon chain cDNA. Nucleic Acids Res. 1983 Feb 11;11(3):719-26. [Article]
- Heilig R, Eckenberg R, Petit JL, Fonknechten N, Da Silva C, Cattolico L, Levy M, Barbe V, de Berardinis V, Ureta-Vidal A, Pelletier E, Vico V, Anthouard V, Rowen L, Madan A, Qin S, Sun H, Du H, Pepin K, Artiguenave F, Robert C, Cruaud C, Bruls T, Jaillon O, Friedlander L, Samson G, Brottier P, Cure S, Segurens B, Aniere F, Samain S, Crespeau H, Abbasi N, Aiach N, Boscus D, Dickhoff R, Dors M, Dubois I, Friedman C, Gouyvenoux M, James R, Madan A, Mairey-Estrada B, Mangenot S, Martins N, Menard M, Oztas S, Ratcliffe A, Shaffer T, Trask B, Vacherie B, Bellemere C, Belser C, Besnard-Gonnet M, Bartol-Mavel D, Boutard M, Briez-Silla S, Combette S, Dufosse-Laurent V, Ferron C, Lechaplais C, Louesse C, Muselet D, Magdelenat G, Pateau E, Petit E, Sirvain-Trukniewicz P, Trybou A, Vega-Czarny N, Bataille E, Bluet E, Bordelais I, Dubois M, Dumont C, Guerin T, Haffray S, Hammadi R, Muanga J, Pellouin V, Robert D, Wunderle E, Gauguet G, Roy A, Sainte-Marthe L, Verdier J, Verdier-Discala C, Hillier L, Fulton L, McPherson J, Matsuda F, Wilson R, Scarpelli C, Gyapay G, Wincker P, Saurin W, Quetier F, Waterston R, Hood L, Weissenbach J: The DNA sequence and analysis of human chromosome 14. Nature. 2003 Feb 6;421(6923):601-7. Epub 2003 Jan 1. [Article]
- Kenten JH, Molgaard HV, Houghton M, Derbyshire RB, Viney J, Bell LO, Gould HJ: Cloning and sequence determination of the gene for the human immunoglobulin epsilon chain expressed in a myeloma cell line. Proc Natl Acad Sci U S A. 1982 Nov;79(21):6661-5. [Article]
- Lefranc MP: Nomenclature of the human immunoglobulin heavy (IGH) genes. Exp Clin Immunogenet. 2001;18(2):100-16. [Article]
- Teng G, Papavasiliou FN: Immunoglobulin somatic hypermutation. Annu Rev Genet. 2007;41:107-20. [Article]
- Schroeder HW Jr, Cavacini L: Structure and function of immunoglobulins. J Allergy Clin Immunol. 2010 Feb;125(2 Suppl 2):S41-52. doi: 10.1016/j.jaci.2009.09.046. [Article]
- McHeyzer-Williams M, Okitsu S, Wang N, McHeyzer-Williams L: Molecular programming of B cell memory. Nat Rev Immunol. 2011 Dec 9;12(1):24-34. doi: 10.1038/nri3128. [Article]
- Padlan EA, Davies DR: A model of the Fc of immunoglobulin E. Mol Immunol. 1986 Oct;23(10):1063-75. [Article]
Associated Data
- Drug Relations
Drug Drug group Pharmacological action? Type Actions Details Ligelizumab investigational yes target antibody Details Omalizumab approved, investigational yes target antibodyneutralizer Details