Teplizumab

This drug entry is a stub and has not been fully annotated. It is scheduled to be annotated soon.

Identification

Generic Name
Teplizumab
DrugBank Accession Number
DB06606
Background

Not Available

Type
Biotech
Groups
Investigational
Biologic Classification
Protein Based Therapies
Monoclonal antibody (mAb)
Protein Structure
Db06606
Protein Chemical Formula
Not Available
Protein Average Weight
Not Available
Sequences
>8869_H|teplizumab|Humanized||H-GAMMA-1 (VH(1-119)+CH1(120-217)+HINGE-REGION(218-232)+CH2(233-342)+CH3(343-449))|||||||449||||MW 49611.9|MW 49611.9|
QVQLVQSGGGVVQPGRSLRLSCKASGYTFTRYTMHWVRQAPGKGLEWIGYINPSRGYTNY
NQKVKDRFTISRDNSKNTAFLQMDSLRPEDTGVYFCARYYDDHYCLDYWGQGTPVTVSSA
STKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSG
LYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPEAAGGP
SVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNS
TYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDEL
TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQ
QGNVFSCSVMHEALHNHYTQKSLSLSPGK
>8869_L|teplizumab|Humanized||L-KAPPA (V-KAPPA(1-105)+C-KAPPA(107-213))|||||||213||||MW 23304.7|MW 23304.7|
DIQMTQSPSSLSASVGDRVTITCSASSSVSYMNWYQQTPGKAPKRWIYDTSKLASGVPSR
FSGSGSGTDYTFTISSLQPEDIATYYCQQWSSNPFTFGQGTKLQITRTVAAPSVFIFPPS
DEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTL
SKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
Download FASTA Format
Synonyms
  • Teplizumab
External IDs
  • MGA-031
  • MGA031

Pharmacology

Indication

Investigated for use/treatment in diabetes mellitus type 1.

Pharmacology
Reduce drug development failure rates
Build, train, & validate machine-learning models
with evidence-based and structured datasets.
See how
Build, train, & validate predictive machine-learning models with structured datasets.
See how
Contraindications & Blackbox Warnings
Contraindications
Avoid life-threatening adverse drug events
Improve clinical decision support with information on contraindications & blackbox warnings, population restrictions, harmful risks, & more.
Learn more
Avoid life-threatening adverse drug events & improve clinical decision support.
Learn more
Pharmacodynamics

Not Available

Mechanism of action
Not Available
Absorption

Not Available

Volume of distribution

Not Available

Protein binding

Not Available

Metabolism
Not Available
Route of elimination

Not Available

Half-life

Not Available

Clearance

Not Available

Adverse Effects
Adverseeffects
Improve decision support & research outcomes
With structured adverse effects data, including: blackbox warnings, adverse reactions, warning & precautions, & incidence rates.
Learn more
Improve decision support & research outcomes with our structured adverse effects data.
Learn more
Toxicity

Not Available

Pathways
Not Available
Pharmacogenomic Effects/ADRs
Not Available

Interactions

Drug Interactions
This information should not be interpreted without the help of a healthcare provider. If you believe you are experiencing an interaction, contact a healthcare provider immediately. The absence of an interaction does not necessarily mean no interactions exist.
DrugInteraction
AbciximabThe risk or severity of adverse effects can be increased when Abciximab is combined with Teplizumab.
AdalimumabThe risk or severity of adverse effects can be increased when Adalimumab is combined with Teplizumab.
AducanumabThe risk or severity of adverse effects can be increased when Teplizumab is combined with Aducanumab.
AlemtuzumabThe risk or severity of adverse effects can be increased when Alemtuzumab is combined with Teplizumab.
AlirocumabThe risk or severity of adverse effects can be increased when Teplizumab is combined with Alirocumab.
AmivantamabThe risk or severity of adverse effects can be increased when Teplizumab is combined with Amivantamab.
AnifrolumabThe risk or severity of adverse effects can be increased when Teplizumab is combined with Anifrolumab.
AnsuvimabThe risk or severity of adverse effects can be increased when Teplizumab is combined with Ansuvimab.
Anthrax immune globulin humanThe risk or severity of adverse effects can be increased when Teplizumab is combined with Anthrax immune globulin human.
Antilymphocyte immunoglobulin (horse)The risk or severity of adverse effects can be increased when Teplizumab is combined with Antilymphocyte immunoglobulin (horse).
Interactions
Identify potential medication risks
Easily compare up to 40 drugs with our drug interaction checker.
Get severity rating, description, and management advice.
Learn more
Food Interactions
Not Available

Categories

Drug Categories
Chemical TaxonomyProvided by Classyfire
Description
Not Available
Kingdom
Organic Compounds
Super Class
Organic Acids
Class
Carboxylic Acids and Derivatives
Sub Class
Amino Acids, Peptides, and Analogues
Direct Parent
Peptides
Alternative Parents
Not Available
Substituents
Not Available
Molecular Framework
Not Available
External Descriptors
Not Available
Affected organisms
Not Available

Chemical Identifiers

UNII
S4M959U2IJ
CAS number
876387-05-2

References

General References
Not Available
Wikipedia
Teplizumab

Clinical Trials

Clinical Trials
PhaseStatusPurposeConditionsCount
3CompletedTreatmentType 1 Diabetes Mellitus1
3RecruitingTreatmentType 1 Diabetes Mellitus1
2CompletedTreatmentAutoantibody Positive / High Risk / Impaired Glucose Tolerance / Non-diabetic Relatives at Risk for Type 1 Diabetes1
2CompletedTreatmentType 1 Diabetes Mellitus2
2RecruitingTreatmentType 1 Diabetes Mellitus1
2TerminatedTreatmentType 1 Diabetes Mellitus1
2, 3CompletedTreatmentType 1 Diabetes Mellitus1
2, 3TerminatedTreatmentType 1 Diabetes Mellitus1
1, 2Active Not RecruitingTreatmentType 1 Diabetes Mellitus1
1, 2TerminatedTreatmentPsoriasis (PsO)1

Pharmacoeconomics

Manufacturers
Not Available
Packagers
Not Available
Dosage Forms
Not Available
Prices
Not Available
Patents
Not Available

Properties

State
Solid
Experimental Properties
Not Available

Drug created on March 19, 2008 16:40 / Updated on February 21, 2021 18:52