Beta-phosphoglucomutase
Details
- Name
- Beta-phosphoglucomutase
- Kind
- protein
- Synonyms
- 5.4.2.6
- Beta-PGM
- Gene Name
- pgmB
- UniProtKB Entry
- P71447Swiss-Prot
- Organism
- Lactococcus lactis subsp. lactis (strain IL1403)
- NCBI Taxonomy ID
- 272623
- Amino acid sequence
>lcl|BSEQ0010948|Beta-phosphoglucomutase MFKAVLFDLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLA DKKVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGP FLLEKMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKD SGALPIGVGRPEDLGDDIVIVPDTSYYTLEFLKEVWLQKQK
- Number of residues
- 221
- Molecular Weight
- 24208.37
- Theoretical pI
- 4.6
- GO Classification
- Functionsbeta-phosphoglucomutase activity / hydrolase activity / magnesium ion bindingProcessescarbohydrate metabolic processComponentscytoplasm
- General Function
- Catalyzes the interconversion of D-glucose 1-phosphate (G1P) and D-glucose 6-phosphate (G6P), forming beta-D-glucose 1,6-(bis)phosphate (beta-G16P) as an intermediate. The beta-phosphoglucomutase (Beta-PGM) acts on the beta-C(1) anomer of G1P. Glucose or lactose are used in preference to maltose, which is only utilized after glucose or lactose has been exhausted. It plays a key role in the regulation of the flow of carbohydrate intermediates in glycolysis and the formation of the sugar nucleotide UDP-glucose.
- Specific Function
- beta-phosphoglucomutase activity
- Pfam Domain Function
- Not Available
- Signal Regions
- Not Available
- Transmembrane Regions
- Not Available
- Cellular Location
- Cytoplasm
- Gene sequence
>lcl|BSEQ0010949|Beta-phosphoglucomutase (pgmB) ATGTTTAAAGCAGTATTGTTTGATTTAGATGGTGTAATTACAGATACCGCAGAGTATCAT TTTAGAGCTTGGAAAGCTTTGGCTGAAGAAATTGGCATTAATGGTGTTGACCGCCAATTT AATGAGCAATTAAAAGGGGTCTCACGAGAAGACTCGCTTCAGAAAATTCTAGATTTAGCT GATAAAAAAGTATCAGCTGAGGAATTTAAAGAACTTGCTAAGAGAAAAAATGATAACTAT GTGAAAATGATTCAGGATGTGTCGCCAGCCGATGTCTATCCTGGAATTTTACAATTACTC AAAGATTTACGTTCAAATAAAATCAAAATTGCTTTAGCATCGGCTTCTAAGAATGGTCCA TTTTTATTAGAGAAAATGAATTTAACTGGATATTTTGATGCAATTGCTGATCCGGCTGAA GTTGCAGCATCAAAACCAGCACCAGATATTTTTATTGCAGCAGCACATGCAGTGGGTGTT GCCCCCTCTGAATCAATTGGGTTAGAGGATTCTCAAGCTGGAATTCAAGCCATCAAAGAT TCAGGGGCTTTACCAATTGGTGTAGGGCGCCCAGAAGATTTGGGAGATGATATCGTCATT GTGCCTGATACTTCATACTATACATTAGAATTTTTGAAAGAAGTTTGGCTTCAAAAGCAA AAATGA
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P71447 UniProtKB Entry Name PGMB_LACLA GenBank Protein ID 1495997 GenBank Gene ID Z70730 PDB ID(s) 1LVH, 1O03, 1O08, 1Z4N, 1Z4O, 1ZOL, 2WF5, 2WF6, 2WF7, 2WF8, 2WF9, 2WFA, 2WHE, 3FM9, 3ZI4, 4C4R, 4C4S, 4C4T KEGG ID lla:L0001 NCBI Gene ID 1114041 - General References
- Qian N, Stanley GA, Bunte A, Radstrom P: Product formation and phosphoglucomutase activities in Lactococcus lactis: cloning and characterization of a novel phosphoglucomutase gene. Microbiology. 1997 Mar;143 ( Pt 3):855-65. [Article]
- Bolotin A, Wincker P, Mauger S, Jaillon O, Malarme K, Weissenbach J, Ehrlich SD, Sorokin A: The complete genome sequence of the lactic acid bacterium Lactococcus lactis ssp. lactis IL1403. Genome Res. 2001 May;11(5):731-53. [Article]
- Qian N, Stanley GA, Hahn-Hagerdal B, Radstrom P: Purification and characterization of two phosphoglucomutases from Lactococcus lactis subsp. lactis and their regulation in maltose- and glucose-utilizing cells. J Bacteriol. 1994 Sep;176(17):5304-11. [Article]
- Lahiri SD, Zhang G, Dai J, Dunaway-Mariano D, Allen KN: Analysis of the substrate specificity loop of the HAD superfamily cap domain. Biochemistry. 2004 Mar 16;43(10):2812-20. [Article]
- Lahiri SD, Zhang G, Dunaway-Mariano D, Allen KN: Caught in the act: the structure of phosphorylated beta-phosphoglucomutase from Lactococcus lactis. Biochemistry. 2002 Jul 2;41(26):8351-9. [Article]
- Lahiri SD, Zhang G, Dunaway-Mariano D, Allen KN: The pentacovalent phosphorus intermediate of a phosphoryl transfer reaction. Science. 2003 Mar 28;299(5615):2067-71. Epub 2003 Mar 13. [Article]
- Zhang G, Dai J, Wang L, Dunaway-Mariano D, Tremblay LW, Allen KN: Catalytic cycling in beta-phosphoglucomutase: a kinetic and structural analysis. Biochemistry. 2005 Jul 12;44(27):9404-16. [Article]
- Tremblay LW, Zhang G, Dai J, Dunaway-Mariano D, Allen KN: Chemical confirmation of a pentavalent phosphorane in complex with beta-phosphoglucomutase. J Am Chem Soc. 2005 Apr 20;127(15):5298-9. [Article]
- Dai J, Finci L, Zhang C, Lahiri S, Zhang G, Peisach E, Allen KN, Dunaway-Mariano D: Analysis of the structural determinants underlying discrimination between substrate and solvent in beta-phosphoglucomutase catalysis. Biochemistry. 2009 Mar 10;48(9):1984-95. doi: 10.1021/bi801653r. [Article]
- Baxter NJ, Bowler MW, Alizadeh T, Cliff MJ, Hounslow AM, Wu B, Berkowitz DB, Williams NH, Blackburn GM, Waltho JP: Atomic details of near-transition state conformers for enzyme phosphoryl transfer revealed by MgF-3 rather than by phosphoranes. Proc Natl Acad Sci U S A. 2010 Mar 9;107(10):4555-60. doi: 10.1073/pnas.0910333106. Epub 2010 Feb 17. [Article]
Associated Data
- Drug Relations
Drug Drug group Pharmacological action? Type Actions Details Phosphoaspartate experimental unknown target Details Alpha-D-Galactose-1-Phosphate experimental unknown target Details Alpha-D-Glucose 1,6-Bisphosphate experimental unknown target Details