2-hydroxymuconate tautomerase
Details
- Name
- 2-hydroxymuconate tautomerase
- Kind
- protein
- Synonyms
- 4-OT
- 4-oxalocrotonate tautomerase
- 5.3.2.6
- Gene Name
- xylH
- UniProtKB Entry
- Q01468Swiss-Prot
- Organism
- Pseudomonas putida
- NCBI Taxonomy ID
- 303
- Amino acid sequence
>lcl|BSEQ0016418|2-hydroxymuconate tautomerase MPIAQIHILEGRSDEQKETLIREVSEAISRSLDAPLTSVRVIITEMAKGHFGIGGELASK VRR
- Number of residues
- 63
- Molecular Weight
- 6941.95
- Theoretical pI
- 7.72
- GO Classification
- Functionsisomerase activityProcessestoluene catabolic process / xylene catabolic process
- General Function
- Catalyzes the ketonization of 2-hydroxymuconate stereoselectively to yield 2-oxo-3-hexenedioate.
- Specific Function
- isomerase activity
- Pfam Domain Function
- Tautomerase (PF01361)
- Signal Regions
- Not Available
- Transmembrane Regions
- Not Available
- Cellular Location
- Not Available
- Gene sequence
>lcl|BSEQ0016419|2-hydroxymuconate tautomerase (xylH) ATGCCTATTGCCCAGATCCACATCCTTGAAGGCCGCAGCGACGAGCAGAAGGAAACCCTC ATTCGGGAAGTCAGCGAGGCCATCTCGCGCTCCCTGGATGCGCCGCTGACCAGCGTGCGA GTGATTATCACGGAGATGGCCAAGGGCCACTTCGGCATCGGCGGCGAACTGGCCAGCAAG GTCAGACGCTGA
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID Q01468 UniProtKB Entry Name 4OT1_PSEPU GenBank Protein ID 151717 GenBank Gene ID M95650 PDB ID(s) 1BJP, 2FM7, 4OTA, 4OTB, 4OTC, 4X19, 4X1C KEGG ID pg:1218749 NCBI Gene ID 1218749 - General References
- Chen LH, Kenyon GL, Curtin F, Harayama S, Bembenek ME, Hajipour G, Whitman CP: 4-Oxalocrotonate tautomerase, an enzyme composed of 62 amino acid residues per monomer. J Biol Chem. 1992 Sep 5;267(25):17716-21. [Article]
- Harayama S, Rekik M: Comparison of the nucleotide sequences of the meta-cleavage pathway genes of TOL plasmid pWW0 from Pseudomonas putida with other meta-cleavage genes suggests that both single and multiple nucleotide substitutions contribute to enzyme evolution. Mol Gen Genet. 1993 May;239(1-2):81-9. [Article]
- Greated A, Lambertsen L, Williams PA, Thomas CM: Complete sequence of the IncP-9 TOL plasmid pWW0 from Pseudomonas putida. Environ Microbiol. 2002 Dec;4(12):856-71. [Article]
- Subramanya HS, Roper DI, Dauter Z, Dodson EJ, Davies GJ, Wilson KS, Wigley DB: Enzymatic ketonization of 2-hydroxymuconate: specificity and mechanism investigated by the crystal structures of two isomerases. Biochemistry. 1996 Jan 23;35(3):792-802. [Article]
- Taylor AB, Czerwinski RM, Johnson WH Jr, Whitman CP, Hackert ML: Crystal structure of 4-oxalocrotonate tautomerase inactivated by 2-oxo-3-pentynoate at 2.4 A resolution: analysis and implications for the mechanism of inactivation and catalysis. Biochemistry. 1998 Oct 20;37(42):14692-700. [Article]
- Stivers JT, Abeygunawardana C, Mildvan AS, Hajipour G, Whitman CP, Chen LH: Catalytic role of the amino-terminal proline in 4-oxalocrotonate tautomerase: affinity labeling and heteronuclear NMR studies. Biochemistry. 1996 Jan 23;35(3):803-13. [Article]
Associated Data
- Drug Relations
Drug Drug group Pharmacological action? Type Actions Details 2-Oxo-3-Pentenoic Acid experimental unknown target Details