S-ribosylhomocysteine lyase
Details
- Name
- S-ribosylhomocysteine lyase
- Kind
- protein
- Synonyms
- 4.4.1.21
- AI-2 synthesis protein
- Autoinducer-2 production protein LuxS
- Gene Name
- luxS
- UniProtKB Entry
- Q9RRU8Swiss-Prot
- Organism
- Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422)
- NCBI Taxonomy ID
- 243230
- Amino acid sequence
>lcl|BSEQ0016434|S-ribosylhomocysteine lyase MPDMANVESFDLDHTKVKAPYVRLAGVKTTPKGDQISKYDLRFLQPNQGAIDPAAIHTLE HLLAGYMRDHLEGVVDVSPMGCRTGMYMAVIGEPDEQGVMKAFEAALKDTAGHDQPIPGV SELECGNYRDHDLAAARQHARDVLDQGLKVQETILLER
- Number of residues
- 158
- Molecular Weight
- 17394.625
- Theoretical pI
- 5.01
- GO Classification
- Functionsiron ion binding / S-ribosylhomocysteine lyase activityProcessesquorum sensing
- General Function
- Involved in the synthesis of autoinducer 2 (AI-2) which is secreted by bacteria and is used to communicate both the cell density and the metabolic potential of the environment. The regulation of gene expression in response to changes in cell density is called quorum sensing. Catalyzes the transformation of S-ribosylhomocysteine (RHC) to homocysteine (HC) and 4,5-dihydroxy-2,3-pentadione (DPD).
- Specific Function
- iron ion binding
- Pfam Domain Function
- LuxS (PF02664)
- Signal Regions
- Not Available
- Transmembrane Regions
- Not Available
- Cellular Location
- Not Available
- Gene sequence
>lcl|BSEQ0016435|S-ribosylhomocysteine lyase (luxS) ATGCCCGACATGGCAAACGTCGAATCGTTCGATCTGGACCACACCAAGGTCAAGGCTCCC TATGTCCGCCTCGCCGGGGTCAAGACCACCCCGAAGGGTGACCAGATCTCCAAGTACGAC CTGCGCTTCTTGCAGCCCAACCAGGGCGCCATCGACCCCGCCGCCATTCACACGCTCGAG CACCTGCTGGCGGGCTACATGCGCGACCACCTCGAGGGCGTGGTGGACGTGTCCCCGATG GGCTGCCGCACCGGCATGTACATGGCCGTCATCGGTGAACCCGACGAGCAGGGCGTGATG AAAGCCTTCGAGGCGGCCCTCAAGGACACCGCCGGGCACGACCAACCCATTCCCGGCGTG AGCGAACTCGAATGCGGCAACTACCGCGACCACGACCTCGCCGCCGCCCGCCAGCACGCC CGCGACGTGCTCGACCAGGGGCTGAAAGTTCAGGAAACCATTCTGCTCGAACGCTGA
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID Q9RRU8 UniProtKB Entry Name LUXS_DEIRA GenBank Protein ID 6460202 GenBank Gene ID AE000513 PDB ID(s) 1INN, 1J6V, 1VGX, 1VH2, 1VJE KEGG ID dra:DR_2387 NCBI Gene ID 1797935 - General References
- White O, Eisen JA, Heidelberg JF, Hickey EK, Peterson JD, Dodson RJ, Haft DH, Gwinn ML, Nelson WC, Richardson DL, Moffat KS, Qin H, Jiang L, Pamphile W, Crosby M, Shen M, Vamathevan JJ, Lam P, McDonald L, Utterback T, Zalewski C, Makarova KS, Aravind L, Daly MJ, Minton KW, Fleischmann RD, Ketchum KA, Nelson KE, Salzberg S, Smith HO, Venter JC, Fraser CM: Genome sequence of the radioresistant bacterium Deinococcus radiodurans R1. Science. 1999 Nov 19;286(5444):1571-7. [Article]
- Lewis HA, Furlong EB, Laubert B, Eroshkina GA, Batiyenko Y, Adams JM, Bergseid MG, Marsh CD, Peat TS, Sanderson WE, Sauder JM, Buchanan SG: A structural genomics approach to the study of quorum sensing: crystal structures of three LuxS orthologs. Structure. 2001 Jun;9(6):527-37. [Article]
Associated Data
- Drug Relations
Drug Drug group Pharmacological action? Type Actions Details 3-sulfino-L-alanine experimental unknown target Details