Nuclease P1
Details
- Name
- Nuclease P1
- Kind
- protein
- Synonyms
- 3.1.30.1
- Deoxyribonuclease P1
- Endonuclease P1
- Gene Name
- Not Available
- UniProtKB Entry
- P24289Swiss-Prot
- Organism
- Penicillium citrinum
- NCBI Taxonomy ID
- 5077
- Amino acid sequence
>lcl|BSEQ0016482|Nuclease P1 WGALGHATVAYVAQHYVSPEAASWAQGILGSSSSSYLASIASWADEYRLTSAGKWSASLH FIDAEDNPPTNCNVDYERDCGSSGCSISAIANYTQRVSDSSLSSENHAEALRFLVHFIGD MTQPLHDEAYAVGGNKINVTFDGYHDNLHSDWDTYMPQKLIGGHALSDAESWAKTLVQNI ESGNYTAQAIGWIKGDNISEPITTATRWASDANALVCTVVMPHGAAALQTGDLYPTYYDS VIDTIELQIAKGGYRLANWINEIHGSEIAK
- Number of residues
- 270
- Molecular Weight
- 29226.835
- Theoretical pI
- 4.52
- GO Classification
- Functionsendonuclease activity / metal ion binding / nucleic acid bindingProcessesDNA catabolic processComponentsextracellular region
- General Function
- Hydrolyzes only single-stranded DNA and RNA without apparent specificity for bases.
- Specific Function
- endonuclease activity
- Pfam Domain Function
- S1-P1_nuclease (PF02265)
- Signal Regions
- Not Available
- Transmembrane Regions
- Not Available
- Cellular Location
- Secreted
- Gene sequence
- Not Available
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P24289 UniProtKB Entry Name NUP1_PENCI PDB ID(s) 1AK0 - General References
- Maekawa K, Tsunasawa S, Dibo G, Sakiyama F: Primary structure of nuclease P1 from Penicillium citrinum. Eur J Biochem. 1991 Sep 15;200(3):651-61. [Article]
- Volbeda A, Lahm A, Sakiyama F, Suck D: Crystal structure of Penicillium citrinum P1 nuclease at 2.8 A resolution. EMBO J. 1991 Jul;10(7):1607-18. [Article]
- Romier C, Dominguez R, Lahm A, Dahl O, Suck D: Recognition of single-stranded DNA by nuclease P1: high resolution crystal structures of complexes with substrate analogs. Proteins. 1998 Sep 1;32(4):414-24. [Article]
Associated Data
- Drug Relations
Drug Drug group Pharmacological action? Type Actions Details Thymidine-5'-(dithio)phosphate experimental unknown target Details Adenosine-5'-(Dithio)Phosphate experimental unknown target Details