Nucleoside deoxyribosyltransferase
Details
- Name
- Nucleoside deoxyribosyltransferase
- Kind
- protein
- Synonyms
- 2.4.2.6
- N-deoxyribosyltransferase
- Gene Name
- ntd
- UniProtKB Entry
- Q9R5V5Swiss-Prot
- Organism
- Lactobacillus leichmannii
- NCBI Taxonomy ID
- 28039
- Amino acid sequence
>lcl|BSEQ0016521|Nucleoside deoxyribosyltransferase MPKKTIYFGAGWFTDRQNKAYKEAMEALKENPTIDLENSYVPLDNQYKGIRVDEHPEYLH DKVWATATYNNDLNGIKTNDIMLGVYIPDEEDVGLGMELGYALSQGKYVLLVIPDEDYGK PINLMSWGVSDNVIKMSQLKDFNFNKPRFDFYEGAVY
- Number of residues
- 157
- Molecular Weight
- 18080.3
- Theoretical pI
- 4.41
- GO Classification
- Functionsdeoxyribonucleoside 5'-monophosphate N-glycosidase activity / nucleoside deoxyribosyltransferase activityProcessesdeoxyribonucleoside monophosphate catabolic process / nucleotide salvage
- General Function
- Catalyzes the cleavage of the glycosidic bond of 2'-deoxyribonucleosides and the transfer of the deoxyribosyl moiety to an acceptor purine or pyrimidine base.
- Specific Function
- nucleoside deoxyribosyltransferase activity
- Pfam Domain Function
- Nuc_deoxyrib_tr (PF05014)
- Signal Regions
- Not Available
- Transmembrane Regions
- Not Available
- Cellular Location
- Not Available
- Gene sequence
- Not Available
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID Q9R5V5 UniProtKB Entry Name NTD_LACLE PDB ID(s) 1F8X, 1F8Y, 4HX9 - General References
- Porter DJ, Merrill BM, Short SA: Identification of the active site nucleophile in nucleoside 2-deoxyribosyltransferase as glutamic acid 98. J Biol Chem. 1995 Jun 30;270(26):15551-6. [Article]
- Armstrong SR, Cook WJ, Short SA, Ealick SE: Crystal structures of nucleoside 2-deoxyribosyltransferase in native and ligand-bound forms reveal architecture of the active site. Structure. 1996 Jan 15;4(1):97-107. [Article]
Associated Data
- Drug Relations
Drug Drug group Pharmacological action? Type Actions Details 5-methyl-2'-deoxypseudouridine experimental unknown target Details