Cytochrome c-552
Details
- Name
- Cytochrome c-552
- Kind
- protein
- Synonyms
- Cytochrome c552
- Gene Name
- cycA
- UniProtKB Entry
- P04164Swiss-Prot
- Organism
- Thermus thermophilus
- NCBI Taxonomy ID
- 274
- Amino acid sequence
>lcl|BSEQ0011290|Cytochrome c-552 QADGAKIYAQCAGCHQQNGQGIPGAFPPLAGHVAEILAKEGGREYLILVLLYGLQGQIEV KGMKYNGVMSSFAQLKDEEIAAVLNHIATAWGDAKKVKGFKPFTAEEVKKLRAKKLTPQQ VLAERKKLGLK
- Number of residues
- 131
- Molecular Weight
- 14172.51
- Theoretical pI
- 10.02
- GO Classification
- Functionselectron carrier activity / heme binding / metal ion bindingProcessesoxidation-reduction process
- General Function
- This monoheme basic protein appears to function as an electron donor to cytochrome oxidase in T.thermophilus.
- Specific Function
- electron transfer activity
- Pfam Domain Function
- Cytochrom_C (PF00034)
- Signal Regions
- Not Available
- Transmembrane Regions
- Not Available
- Cellular Location
- Not Available
- Gene sequence
- Not Available
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P04164 UniProtKB Entry Name CY552_THETH PDB ID(s) 1C52, 1QYZ, 1R0Q, 2FWL, 3VNW - General References
- Than ME, Hof P, Huber R, Bourenkov GP, Bartunik HD, Buse G, Soulimane T: Thermus thermophilus cytochrome-c552: A new highly thermostable cytochrome-c structure obtained by MAD phasing. J Mol Biol. 1997 Aug 29;271(4):629-44. [Article]
Associated Data
- Drug Relations
Drug Drug group Pharmacological action? Type Actions Details 2-Acetyl-Protoporphyrin Ix experimental unknown target Details 2-Formyl-Protoporphryn Ix experimental unknown target Details