Neocarzinostatin
Details
- Name
- Neocarzinostatin
- Kind
- protein
- Synonyms
- Mitomalcin
- MMC
- NCS
- Gene Name
- ncsA
- UniProtKB Entry
- P0A3S0Swiss-Prot
- Organism
- Streptomyces malayensis
- NCBI Taxonomy ID
- 1918
- Amino acid sequence
>lcl|BSEQ0011321|Neocarzinostatin AAPTATVTPSSGLSDGTVVKVAGAGLQAGTAYDVGQCAWVDTGVLACNPADFSSVTADAN GSASTSLTVRRSFEGFLFDGTRWGTVDCTTAACQVGLSDAAGNGPEGVAISFN
- Number of residues
- 113
- Molecular Weight
- 11096.03
- Theoretical pI
- 3.83
- GO Classification
- FunctionsDNA bindingProcessesdefense response to bacterium
- General Function
- NCS has antibiotic activity (for Gram-positive bacteria) and antitumor activity (for certain mouse tumors). NCS binds non-covalently to a chromophore which is the cytotoxic and mutagenic component of the antibiotic. The chromophore binds to DNA as a weak intercalator and causes single- and double-strand breaks.
- Specific Function
- DNA binding
- Pfam Domain Function
- Neocarzinostat (PF00960)
- Signal Regions
- Not Available
- Transmembrane Regions
- Not Available
- Cellular Location
- Cytoplasmic
- Gene sequence
- Not Available
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P0A3S0 UniProtKB Entry Name NCZS_STRML PDB ID(s) 4JW3 - General References
- Gao XL, Burkhart W: Two- and three-dimensional proton NMR studies of apo-neocarzinostatin. Biochemistry. 1991 Aug 6;30(31):7730-9. [Article]
Associated Data
- Drug Relations
Drug Drug group Pharmacological action? Type Actions Details Ncs-Chromophore experimental unknown target Details