Pseudoazurin
Details
- Name
- Pseudoazurin
- Kind
- protein
- Synonyms
- Blue copper protein
- Cupredoxin
- Gene Name
- Not Available
- UniProtKB Entry
- P04377Swiss-Prot
- Organism
- Alcaligenes faecalis
- NCBI Taxonomy ID
- 511
- Amino acid sequence
>lcl|BSEQ0011407|Pseudoazurin MRNIAIKFAAAGILAMLAAPALAENIEVHMLNKGAEGAMVFEPAYIKANPGDTVTFIPVD KGHNVESIKDMIPEGAEKFKSKINENYVLTVTQPGAYLVKCTPHYAMGMIALIAVGDSPA NLDQIVSAKKPKIVQERLEKVIASAK
- Number of residues
- 146
- Molecular Weight
- 15647.255
- Theoretical pI
- 8.45
- GO Classification
- Functionscopper ion binding / electron carrier activityProcessesoxidation-reduction processComponentsperiplasmic space
- General Function
- This soluble electron transfer copper protein is required for the inactivation of copper-containing nitrite reductase in the presence of oxygen. Serves as a direct electron donor to the nitrite reductase.
- Specific Function
- copper ion binding
- Pfam Domain Function
- Copper-bind (PF00127)
- Signal Regions
- 1-23
- Transmembrane Regions
- Not Available
- Cellular Location
- Periplasm
- Gene sequence
>lcl|BSEQ0003866|441 bp ATGCGTAACATCGCGATCAAATTTGCTGCCGCAGGCATCCTCGCCATGCTGGCTGCCCCC GCTCTTGCCGAAAATATCGAAGTTCATATGCTCAACAAGGGCGCCGAGGGCGCCATGGTT TTCGAGCCTGCCTATATCAAGGCCAATCCCGGCGACACGGTCACCTTTATTCCGGTGGAC AAAGGACATAATGTCGAATCCATCAAGGACATGATCCCTGAAGGCGCCGAAAAGTTCAAA AGCAAGATCAACGAGAACTATGTGCTGACGGTTACCCAGCCCGGCGCATATCTGGTAAAG TGCACACCGCATTATGCCATGGGTATGATCGCGCTCATCGCTGTCGGTGACAGCCCGGCC AATCTCGACCAGATCGTTTCGGCCAAGAAGCCGAAGATTGTTCAGGAGCGGCTGGAAAAG GTCATCGCCAGCGCCAAATAA
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P04377 UniProtKB Entry Name AZUP_ALCFA GenBank Protein ID 141904 GenBank Gene ID M18267 PDB ID(s) 1PAZ, 1PY0, 1PZA, 1PZB, 1PZC, 2P80, 3NYK, 3PAZ, 4PAZ, 4RH4, 5PAZ, 6PAZ, 7PAZ, 8PAZ - General References
- Yamamoto K, Uozumi T, Beppu T: The blue copper protein gene of Alcaligenes faecalis S-6 directs secretion of blue copper protein from Escherichia coli cells. J Bacteriol. 1987 Dec;169(12):5648-52. [Article]
- Hormel S, Adman E, Walsh KA, Beppu T, Titani K: The amino acid sequence of the blue copper protein of Alcaligenes faecalis. FEBS Lett. 1986 Mar 3;197(1-2):301-4. [Article]
- Petratos K, Banner DW, Beppu T, Wilson KS, Tsernoglou D: The crystal structure of pseudoazurin from Alcaligenes faecalis S-6 determined at 2.9 A resolution. FEBS Lett. 1987 Jun 29;218(2):209-14. [Article]
- Adman ET, Turley S, Bramson R, Petratos K, Banner D, Tsernoglou D, Beppu T, Watanabe H: A 2.0-A structure of the blue copper protein (cupredoxin) from Alcaligenes faecalis S-6. J Biol Chem. 1989 Jan 5;264(1):87-99. [Article]
Associated Data
- Drug Relations
Drug Drug group Pharmacological action? Type Actions Details 7,10,13-Tri(Carboxymethyl)-5,15-Dioxo-4,7,10,13,16-Pentaaza-1,19-Dithianonadecane experimental unknown target Details