Soluble cytochrome b562
Details
- Name
- Soluble cytochrome b562
- Kind
- protein
- Synonyms
- Cytochrome b-562
- Gene Name
- cybC
- UniProtKB Entry
- P0ABE7Swiss-Prot
- Organism
- Escherichia coli
- NCBI Taxonomy ID
- 562
- Amino acid sequence
>lcl|BSEQ0003956|Soluble cytochrome b562 MRKSLLAILAVSSLVFSSASFAADLEDNMETLNDNLKVIEKADNAAQVKDALTKMRAAAL DAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTR NAYHQKYR
- Number of residues
- 128
- Molecular Weight
- 14060.815
- Theoretical pI
- 6.54
- GO Classification
- Functionselectron carrier activity / heme binding / iron ion bindingProcesseselectron transport chainComponentsperiplasmic space
- General Function
- Electron-transport protein of unknown function.
- Specific Function
- electron transfer activity
- Pfam Domain Function
- Cytochrom_B562 (PF07361)
- Signal Regions
- 1-22
- Transmembrane Regions
- Not Available
- Cellular Location
- Periplasm
- Gene sequence
>lcl|BSEQ0003955|387 bp ATGCGTAAAAGCCTGTTAGCTATTCTTGCAGTCTCCTCGTTGGTATTCAGTTCTGCGTCG TTTGCCGCTGATCTTGAAGACAATATGGAAACCCTCAACGACAATTTAAAAGTGATCGAA AAAGCGGATAACGCGGCGCAAGTCAAAGACGCGTTAACGAAGATGCGCGCCGCAGCCCTG GATGCGCAAAAAGCAACGCCGCCGAAGCTCGAAGATAAATCACCGGACAGCCCGGAAATG AAAGATTTCCGCCACGGTTTCGACATTCTGGTCGGTCAGATTGACGACGCGCTGAAGCTG GCAAATGAAGGTAAAGTAAAAGAAGCGCAGGCTGCTGCAGAGCAACTGAAAACGACCCGC AACGCCTATCACCAGAAGTATCGTTAA
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P0ABE7 UniProtKB Entry Name C562_ECOLX GenBank Protein ID 241593 GenBank Gene ID S74736 PDB ID(s) 1APC, 1LM3, 1M6T, 1QPU, 1QQ3, 256B, 2BC5, 2QLA, 3C62, 3C63, 3DE8, 3DE9, 3FOO, 3FOP, 3HNI, 3HNJ, 3HNK, 3HNL, 3IQ5, 3IQ6, 3L1M, 3M15, 3M4B, 3M4C, 3M79, 3NMI, 3NMJ, 3NMK, 3TOL, 3TOM, 3U8P, 4EA3, 4EIY, 4IAQ, 4IAR, 4IB4, 4JE9, 4JEA, 4JEB, 4JKV, 4L6R, 4N6H, 4NC3, 4NTJ, 4O9R, 4OR2, 4PXZ, 4PY0, 4QIM, 4QIN, 4RWA, 4RWD, 4U9D, 4U9E, 4YAY, 4Z34, 4Z35, 4Z36, 4ZUD, 5AWI - General References
- Nikkila H, Gennis RB, Sligar SG: Cloning and expression of the gene encoding the soluble cytochrome b562 of Escherichia coli. Eur J Biochem. 1991 Dec 5;202(2):309-13. [Article]
- Trower MK: PCR cloning, sequence analysis and expression of the cybC genes encoding soluble cytochrome b-562 from Escherichia coli B strain OP7 and K strain NM522. Biochim Biophys Acta. 1993 Jun 10;1143(1):109-11. [Article]
- Itagaki E, Hager LP: The amino acid sequence of cytochrome b562 of Escherichia coli. Biochem Biophys Res Commun. 1968 Sep 30;32(6):1013-9. [Article]
- Mathews FS, Bethge PH, Czerwinski EW: The structure of cytochrome b562 from Escherichia coli at 2.5 A resolution. J Biol Chem. 1979 Mar 10;254(5):1699-706. [Article]
- Lederer F, Glatigny A, Bethge PH, Bellamy HD, Matthew FS: Improvement of the 2.5 A resolution model of cytochrome b562 by redetermining the primary structure and using molecular graphics. J Mol Biol. 1981 Jun 5;148(4):427-48. [Article]
- Hamada K, Bethge PH, Mathews FS: Refined structure of cytochrome b562 from Escherichia coli at 1.4 A resolution. J Mol Biol. 1995 Apr 14;247(5):947-62. [Article]
- Springs SL, Bass SE, Bowman G, Nodelman I, Schutt CE, McLendon GL: A multigeneration analysis of cytochrome b(562) redox variants: evolutionary strategies for modulating redox potential revealed using a library approach. Biochemistry. 2002 Apr 2;41(13):4321-8. [Article]
- Arnesano F, Banci L, Bertini I, Faraone-Mennella J, Rosato A, Barker PD, Fersht AR: The solution structure of oxidized Escherichia coli cytochrome b562. Biochemistry. 1999 Jul 6;38(27):8657-70. [Article]
- Assfalg M, Banci L, Bertini I, Ciofi-Baffoni S, Barker PD: (15)N backbone dynamics of ferricytochrome b(562): comparison with the reduced protein and the R98C variant. Biochemistry. 2001 Oct 30;40(43):12761-71. [Article]
Associated Data
- Drug Relations
Drug Drug group Pharmacological action? Type Actions Details Hybrid Between B and C Type Hemes (Protoporphyrin Ixcontaining Fe) experimental unknown target Details N-1,10-phenanthrolin-5-ylacetamide experimental unknown target Details