CCA-adding enzyme
Details
- Name
- CCA-adding enzyme
- Kind
- protein
- Synonyms
- 2.7.7.72
- CCA tRNA nucleotidyltransferase
- tRNA adenylyl-/cytidylyl- transferase
- tRNA CCA-pyrophosphorylase
- tRNA nucleotidyltransferase
- tRNA-NT
- Gene Name
- cca
- UniProtKB Entry
- Q7SIB1Swiss-Prot
- Organism
- Geobacillus stearothermophilus
- NCBI Taxonomy ID
- 1422
- Amino acid sequence
>lcl|BSEQ0022032|CCA-adding enzyme MKPPFQEALGIIQQLKQHGYDAYFVGGAVRDLLLGRPIGDVDIATSALPEDVMAIFPKTI DVGSKHGTVVVVHKGKAYEVTTFKTDGDYEDYRRPESVTFVRSLEEDLKRRDFTMNAIAM DEYGTIIDPFGGREAIRRRIIRTVGEAEKRFREDALRMMRAVRFVSELGFALAPDTEQAI VQNAPLLAHISVERMTMEMEKLLGGPFAARALPLLAETGLNAYLPGLAGKEKQLRLAAAY RWPWLAAREERWALLCHALGVQESRPFLRAWKLPNKVVDEAGAILTALADIPRPEAWTNE QLFSAGLERALSVETVRAAFTGAPPGPWHEKLRRRFASLPIKTKGELAVNGKDVIEWVGK PAGPWVKEALDAIWRAVVNGEVENEKERIYAWLMERNRTREKNC
- Number of residues
- 404
- Molecular Weight
- 45368.875
- Theoretical pI
- 8.61
- GO Classification
- FunctionsATP / ATP binding / CTP / magnesium ion binding / tRNA binding / tRNA cytidylyltransferase activityProcessesRNA repair / tRNA 3'-terminal CCA addition
- General Function
- Catalyzes the addition and repair of the essential 3'-terminal CCA sequence in tRNAs without using a nucleic acid template. Adds these three nucleotides in the order of C, C, and A to the tRNA nucleotide-73, using CTP and ATP as substrates and producing inorganic pyrophosphate. tRNA 3'-terminal CCA addition is required both for tRNA processing and repair. Also involved in tRNA surveillance by mediating tandem CCA addition to generate a CCACCA at the 3' terminus of unstable tRNAs. While stable tRNAs receive only 3'-terminal CCA, unstable tRNAs are marked with CCACCA and rapidly degraded (By similarity). The structural flexibility of RNA controls the choice between CCA versus CCACCA addition: following the first CCA addition cycle, nucleotide-binding to the active site triggers a clockwise screw motion, producing torque on the RNA. This ejects stable RNAs, whereas unstable RNAs are refolded while bound to the enzyme and subjected to a second CCA catalytic cycle (By similarity).
- Specific Function
- ATP binding
- Pfam Domain Function
- Signal Regions
- Not Available
- Transmembrane Regions
- Not Available
- Cellular Location
- Cytoplasmic
- Gene sequence
- Not Available
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID Q7SIB1 UniProtKB Entry Name CCA_GEOSE PDB ID(s) 1MIV, 1MIW, 1MIY - General References
- Li F, Xiong Y, Wang J, Cho HD, Tomita K, Weiner AM, Steitz TA: Crystal structures of the Bacillus stearothermophilus CCA-adding enzyme and its complexes with ATP or CTP. Cell. 2002 Dec 13;111(6):815-24. [Article]
Associated Data
- Drug Relations
Drug Drug group Pharmacological action? Type Actions Details Cytidine-5'-Triphosphate experimental unknown target Details