Cytochrome c'
Details
- Name
- Cytochrome c'
- Kind
- protein
- Synonyms
- Not Available
- Gene Name
- Not Available
- UniProtKB Entry
- P00138Swiss-Prot
- Organism
- Alcaligenes xylosoxydans xylosoxydans
- NCBI Taxonomy ID
- 85698
- Amino acid sequence
>lcl|BSEQ0012067|Cytochrome c' QFAKPEDAVKYRQSALTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFG PGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACH DAYRKKK
- Number of residues
- 127
- Molecular Weight
- 13628.35
- Theoretical pI
- 9.52
- GO Classification
- Functionselectron carrier activity / heme binding / iron ion bindingProcesseselectron transport chainComponentsperiplasmic space
- General Function
- Cytochrome c' is the most widely occurring bacterial c-type cytochrome. Cytochromes c' are high-spin proteins and the heme has no sixth ligand. Their exact function is not known.
- Specific Function
- electron transfer activity
- Pfam Domain Function
- Cytochrom_C_2 (PF01322)
- Signal Regions
- Not Available
- Transmembrane Regions
- Not Available
- Cellular Location
- Periplasm
- Gene sequence
- Not Available
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P00138 UniProtKB Entry Name CYCP_ALCXX PDB ID(s) 1CGN, 1CGO, 1E83, 1E84, 1E85, 1E86, 2XL6, 2XL8, 2XLD, 2XLE, 2XLH, 2XLM, 2XLO, 2XLV, 2XLW, 2XM0, 2XM4, 2YKZ, 2YL0, 2YL1, 2YL3, 2YL7, 2YLD, 2YLG, 2YLI, 3ZQV, 3ZQY, 3ZTM, 3ZTZ, 3ZWI, 4CDA, 4CDV, 4CDY, 4CIP, 4CJG, 4CJO, 4D4N, 4D4X, 4WGY, 4WGZ, 5AGF - General References
- Ambler RP: The amino acid sequence of cytochrome c' from Alcaligenes sp. N.C.I.B. 11015. Biochem J. 1973 Dec;135(4):751-8. [Article]
- Dobbs AJ, Anderson BF, Faber HR, Baker EN: Three-dimensional structure of cytochrome c' from two Alcaligenes species and the implications for four-helix bundle structures. Acta Crystallogr D Biol Crystallogr. 1996 Mar 1;52(Pt 2):356-68. [Article]
- Lawson DM, Stevenson CE, Andrew CR, Eady RR: Unprecedented proximal binding of nitric oxide to heme: implications for guanylate cyclase. EMBO J. 2000 Nov 1;19(21):5661-71. [Article]
- Andrew CR, Green EL, Lawson DM, Eady RR: Resonance Raman studies of cytochrome c' support the binding of NO and CO to opposite sides of the heme: implications for ligand discrimination in heme-based sensors. Biochemistry. 2001 Apr 3;40(13):4115-22. [Article]
Associated Data
- Drug Relations
Drug Drug group Pharmacological action? Type Actions Details Pidolic acid approved, investigational unknown target Details