Probable thiol peroxidase
Details
- Name
- Probable thiol peroxidase
- Kind
- protein
- Synonyms
- 1.11.1.-
- Gene Name
- tpx
- UniProtKB Entry
- P9WG35Swiss-Prot
- Organism
- Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
- NCBI Taxonomy ID
- 83332
- Amino acid sequence
>lcl|BSEQ0051207|Probable thiol peroxidase MAQITLRGNAINTVGELPAVGSPAPAFTLTGGDLGVISSDQFRGKSVLLNIFPSVDTPVC ATSVRTFDERAAASGATVLCVSKDLPFAQKRFCGAEGTENVMPASAFRDSFGEDYGVTIA DGPMAGLLARAIVVIGADGNVAYTELVPEIAQEPNYEAALAALGA
- Number of residues
- 165
- Molecular Weight
- 16895.94
- Theoretical pI
- Not Available
- GO Classification
- Functionsdisulfide oxidoreductase activity / peroxidase activity / peroxiredoxin activity / thioredoxin peroxidase activityProcessescell redox homeostasis / evasion or tolerance by symbiont of host-produced nitric oxide / oxidation-reduction process / pathogenesis / response to nitrosative stress / response to oxidative stressComponentscell wall / cytosol / extracellular region
- General Function
- Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides.
- Specific Function
- disulfide oxidoreductase activity
- Pfam Domain Function
- Redoxin (PF08534)
- Signal Regions
- Not Available
- Transmembrane Regions
- Not Available
- Cellular Location
- Not Available
- Gene sequence
>lcl|BSEQ0051208|Probable thiol peroxidase (tpx) ATGGCACAGATAACCCTGCGAGGAAACGCGATCAATACCGTCGGTGAGCTACCTGCTGTC GGATCCCCGGCCCCGGCCTTCACCCTGACCGGGGGCGATCTGGGGGTGATCAGCAGCGAC CAGTTCCGGGGTAAGTCCGTGTTGCTGAACATCTTTCCATCCGTGGACACACCGGTGTGC GCGACGAGTGTGCGAACCTTCGACGAGCGTGCGGCGGCAAGTGGCGCTACCGTGCTGTGT GTCTCGAAGGATCTGCCGTTCGCCCAGAAGCGCTTCTGCGGCGCCGAGGGCACCGAAAAC GTCATGCCCGCGTCGGCATTCCGGGACAGCTTCGGCGAGGATTACGGCGTGACCATCGCC GACGGGCCGATGGCCGGGCTGCTCGCCCGCGCAATCGTGGTGATCGGCGCGGACGGCAAC GTCGCCTACACGGAATTGGTGCCGGAAATCGCGCAAGAACCCAACTACGAAGCGGCGCTG GCCGCGCTGGGCGCCTAG
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P9WG35 UniProtKB Entry Name TPX_MYCTU PDB ID(s) 1XVQ, 1Y25 KEGG ID mtu:Rv1932 NCBI Gene ID 885357 - General References
- Cole ST, Brosch R, Parkhill J, Garnier T, Churcher C, Harris D, Gordon SV, Eiglmeier K, Gas S, Barry CE 3rd, Tekaia F, Badcock K, Basham D, Brown D, Chillingworth T, Connor R, Davies R, Devlin K, Feltwell T, Gentles S, Hamlin N, Holroyd S, Hornsby T, Jagels K, Krogh A, McLean J, Moule S, Murphy L, Oliver K, Osborne J, Quail MA, Rajandream MA, Rogers J, Rutter S, Seeger K, Skelton J, Squares R, Squares S, Sulston JE, Taylor K, Whitehead S, Barrell BG: Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence. Nature. 1998 Jun 11;393(6685):537-44. [Article]
- Kelkar DS, Kumar D, Kumar P, Balakrishnan L, Muthusamy B, Yadav AK, Shrivastava P, Marimuthu A, Anand S, Sundaram H, Kingsbury R, Harsha HC, Nair B, Prasad TS, Chauhan DS, Katoch K, Katoch VM, Kumar P, Chaerkady R, Ramachandran S, Dash D, Pandey A: Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry. Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3. [Article]
Associated Data
- Drug Relations
Drug Drug group Pharmacological action? Type Actions Details S-oxy-L-cysteine experimental unknown target Details