Eotaxin
Details
- Name
- Eotaxin
- Kind
- protein
- Synonyms
- C-C motif chemokine 11
- Eosinophil chemotactic protein
- SCYA11
- Small-inducible cytokine A11
- Gene Name
- CCL11
- UniProtKB Entry
- P51671Swiss-Prot
- Organism
- Humans
- NCBI Taxonomy ID
- 9606
- Amino acid sequence
>lcl|BSEQ0012371|Eotaxin MKVSAALLWLLLIAAAFSPQGLAGPASVPTTCCFNLANRKIPLQRLESYRRITSGKCPQK AVIFKTKLAKDICADPKKKWVQDSMKYLDQKSPTPKP
- Number of residues
- 97
- Molecular Weight
- 10731.7
- Theoretical pI
- 10.65
- GO Classification
- FunctionsCCR3 chemokine receptor binding / protein dimerization activity / receptor ligand activityProcessesantimicrobial humoral immune response mediated by antimicrobial peptide / intracellular calcium ion homeostasis / learning or memory / negative regulation of neurogenesis
- General Function
- In response to the presence of allergens, this protein directly promotes the accumulation of eosinophils, a prominent feature of allergic inflammatory reactions (PubMed:8597956). Binds to CCR3 (PubMed:8631813)
- Specific Function
- CCR chemokine receptor binding
- Pfam Domain Function
- IL8 (PF00048)
- Signal Regions
- 1-23
- Transmembrane Regions
- Not Available
- Cellular Location
- Secreted
- Gene sequence
>lcl|BSEQ0012372|Eotaxin (CCL11) ATGAAGGTCTCCGCAGCACTTCTGTGGCTGCTGCTCATAGCAGCTGCCTTCAGCCCCCAG GGGCTCGCTGGGCCAGCTTCTGTCCCAACCACCTGCTGCTTTAACCTGGCCAATAGGAAG ATACCCCTTCAGCGACTAGAGAGCTACAGGAGAATCACCAGTGGCAAATGTCCCCAGAAA GCTGTGATCTTCAAGACCAAACTGGCCAAGGATATCTGTGCCGACCCCAAGAAGAAGTGG GTGCAGGATTCCATGAAGTATCTGGACCAAAAATCTCCAACTCCAAAGCCATAA
- Chromosome Location
- 17
- Locus
- 17q12
- External Identifiers
Resource Link UniProtKB ID P51671 UniProtKB Entry Name CCL11_HUMAN GenBank Gene ID U46573 GeneCard ID CCL11 GenAtlas ID CCL11 HGNC ID HGNC:10610 PDB ID(s) 1EOT, 2EOT, 2MPM, 7SCS KEGG ID hsa:6356 NCBI Gene ID 6356 - General References
- Garcia-Zepeda EA, Rothenberg ME, Ownbey RT, Celestin J, Leder P, Luster AD: Human eotaxin is a specific chemoattractant for eosinophil cells and provides a new mechanism to explain tissue eosinophilia. Nat Med. 1996 Apr;2(4):449-56. [Article]
- Ponath PD, Qin S, Ringler DJ, Clark-Lewis I, Wang J, Kassam N, Smith H, Shi X, Gonzalo JA, Newman W, Gutierrez-Ramos JC, Mackay CR: Cloning of the human eosinophil chemoattractant, eotaxin. Expression, receptor binding, and functional properties suggest a mechanism for the selective recruitment of eosinophils. J Clin Invest. 1996 Feb 1;97(3):604-12. [Article]
- Kitaura M, Nakajima T, Imai T, Harada S, Combadiere C, Tiffany HL, Murphy PM, Yoshie O: Molecular cloning of human eotaxin, an eosinophil-selective CC chemokine, and identification of a specific eosinophil eotaxin receptor, CC chemokine receptor 3. J Biol Chem. 1996 Mar 29;271(13):7725-30. [Article]
- Bartels J, Schluter C, Richter E, Noso N, Kulke R, Christophers E, Schroder JM: Human dermal fibroblasts express eotaxin: molecular cloning, mRNA expression, and identification of eotaxin sequence variants. Biochem Biophys Res Commun. 1996 Aug 23;225(3):1045-51. [Article]
- Garcia-Zepeda EA, Rothenberg ME, Weremowicz S, Sarafi MN, Morton CC, Luster AD: Genomic organization, complete sequence, and chromosomal location of the gene for human eotaxin (SCYA11), an eosinophil-specific CC chemokine. Genomics. 1997 May 1;41(3):471-6. [Article]
- Hein H, Schluter C, Kulke R, Christophers E, Schroder JM, Bartels J: Genomic organization, sequence, and transcriptional regulation of the human eotaxin gene. Biochem Biophys Res Commun. 1997 Aug 28;237(3):537-42. [Article]
- Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
- Noso N, Bartels J, Mallet AI, Mochizuki M, Christophers E, Schroder JM: Delayed production of biologically active O-glycosylated forms of human eotaxin by tumor-necrosis-factor-alpha-stimulated dermal fibroblasts. Eur J Biochem. 1998 Apr 1;253(1):114-22. [Article]
- Crump MP, Rajarathnam K, Kim KS, Clark-Lewis I, Sykes BD: Solution structure of eotaxin, a chemokine that selectively recruits eosinophils in allergic inflammation. J Biol Chem. 1998 Aug 28;273(35):22471-9. [Article]
Associated Data
- Drug Relations
Drug Drug group Pharmacological action? Type Actions Details Bertilimumab investigational unknown target Details