Subtilisin DY
Details
- Name
- Subtilisin DY
- Kind
- protein
- Synonyms
- 3.4.21.62
- Gene Name
- apr
- UniProtKB Entry
- P00781Swiss-Prot
- Organism
- Bacillus licheniformis
- NCBI Taxonomy ID
- 1402
- Amino acid sequence
>lcl|BSEQ0012612|Subtilisin DY AQTVPYGIPLIKADKVQAQGYKGANVKVGIIDTGIAASHTDLKVVGGASFVSGESYNTDG NGHGTHVAGTVAALDNTTGVLGVAPNVSLYAIKVLNSSGSGTYSAIVSGIEWATQNGLDV INMSLGGPSGSTALKQAVDKAYASGIVVVAAAGNSGSSGSQNTIGYPAKYDSVIAVGAVD SNKNRASFSSVGAELEVMAPGVSVYSTYPSNTYTSLNGTSMASPHVAGAAALILSKYPTL SASQVRNRLSSTATNLGDSFYYGKGLINVEAAAQ
- Number of residues
- 274
- Molecular Weight
- 27435.335
- Theoretical pI
- 7.77
- GO Classification
- Functionsmetal ion binding / serine-type endopeptidase activityProcessessporulation resulting in formation of a cellular sporeComponentsextracellular region
- General Function
- Subtilisin is an extracellular alkaline serine protease, it catalyzes the hydrolysis of proteins and peptide amides.
- Specific Function
- metal ion binding
- Pfam Domain Function
- Peptidase_S8 (PF00082)
- Signal Regions
- Not Available
- Transmembrane Regions
- Not Available
- Cellular Location
- Secreted
- Gene sequence
- Not Available
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P00781 UniProtKB Entry Name SUBD_BACLI PDB ID(s) 1BH6 - General References
- Nedkov P, Oberthur W, Braunitzer G: [Primary structure of subtilisin DY]. Hoppe Seylers Z Physiol Chem. 1983 Nov;364(11):1537-40. [Article]
- Eschenburg S, Genov N, Peters K, Fittkau S, Stoeva S, Wilson KS, Betzel C: Crystal structure of subtilisin DY, a random mutant of subtilisin Carlsberg. Eur J Biochem. 1998 Oct 15;257(2):309-18. [Article]
Associated Data
- Drug Relations
Drug Drug group Pharmacological action? Type Actions Details N-BENZYLOXYCARBONYL-ALA-PRO-3-AMINO-4-PHENYL-BUTAN-2-OL experimental unknown target Details