Cytochrome c oxidase polypeptide 2A
Details
- Name
- Cytochrome c oxidase polypeptide 2A
- Kind
- protein
- Synonyms
- 1.9.3.1
- Cytochrome c ba(3) subunit IIA
- Cytochrome c oxidase polypeptide IIA
- Cytochrome cba3 subunit 2A
- Gene Name
- cbaD
- UniProtKB Entry
- P82543Swiss-Prot
- Organism
- Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)
- NCBI Taxonomy ID
- 300852
- Amino acid sequence
>lcl|BSEQ0012717|Cytochrome c oxidase polypeptide 2A MEEKPKGALAVILVLTLTILVFWLGVYAVFFARG
- Number of residues
- 34
- Molecular Weight
- 3766.595
- Theoretical pI
- 9.25
- GO Classification
- Functionscytochrome-c oxidase activityComponentsintegral component of membrane / plasma membrane / respiratory chain
- General Function
- Not Available
- Specific Function
- cytochrome-c oxidase activity
- Pfam Domain Function
- CoxIIa (PF08113)
- Signal Regions
- Not Available
- Transmembrane Regions
- 4-34
- Cellular Location
- Cell membrane
- Gene sequence
>lcl|BSEQ0012718|Cytochrome c oxidase polypeptide 2A (cbaD) ATGGAAGAAAAGCCCAAAGGCGCACTGGCGGTCATCCTGGTCCTGACCCTCACCATCCTG GTCTTCTGGCTGGGAGTGTACGCCGTCTTCTTCGCTAGGGGGTAG
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P82543 UniProtKB Entry Name COXA_THET8 GenBank Protein ID 55771383 GenBank Gene ID AP008226 PDB ID(s) 1EHK, 1XME, 2QPD, 2QPE, 3BVD, 3EH3, 3EH4, 3EH5, 3QJQ, 3QJR, 3QJS, 3QJT, 3QJU, 3QJV, 3S33, 3S38, 3S39, 3S3A, 3S3B, 3S3C, 3S3D, 3S8F, 3S8G, 4FA7, 4FAA, 4G70, 4G71, 4G72, 4G7Q, 4G7R, 4G7S, 4GP4, 4GP5, 4GP8, 4N4Y KEGG ID ttj:TTHA1133 NCBI Gene ID 3168186 - General References
- Soulimane T, Than ME, Dewor M, Huber R, Buse G: Primary structure of a novel subunit in ba3-cytochrome oxidase from Thermus thermophilus. Protein Sci. 2000 Nov;9(11):2068-73. [Article]
- Soulimane T, Buse G, Bourenkov GP, Bartunik HD, Huber R, Than ME: Structure and mechanism of the aberrant ba(3)-cytochrome c oxidase from thermus thermophilus. EMBO J. 2000 Apr 17;19(8):1766-76. [Article]
Associated Data
- Drug Relations
Drug Drug group Pharmacological action? Type Actions Details B-nonylglucoside experimental unknown target Details