Cytochrome c oxidase subunit 1
Details
- Name
- Cytochrome c oxidase subunit 1
- Kind
- protein
- Synonyms
- 1.9.3.1
- Cytochrome c ba(3) subunit I
- Cytochrome c oxidase polypeptide I
- Cytochrome cba3 subunit 1
- Gene Name
- cbaA
- UniProtKB Entry
- Q56408Swiss-Prot
- Organism
- Thermus thermophilus
- NCBI Taxonomy ID
- 274
- Amino acid sequence
>lcl|BSEQ0012719|Cytochrome c oxidase subunit 1 IRALPWDNPAFVAPVLGLLGFIPGGAGGIVNASFTLDYVVHNTAWVPGHFHLQVASLVTL TAMGSLYWLLPNLTGKPISDAQRRLGLAVVWLWFLGMMIMAVGLHWAG
- Number of residues
- 108
- Molecular Weight
- 11633.705
- Theoretical pI
- 9.16
- GO Classification
- Functionscytochrome-c oxidase activity / heme binding / iron ion bindingProcessesaerobic respiration / oxidative phosphorylationComponentsintegral component of membrane / plasma membrane / respiratory chain
- General Function
- Not Available
- Specific Function
- cytochrome-c oxidase activity
- Pfam Domain Function
- COX1 (PF00115)
- Signal Regions
- Not Available
- Transmembrane Regions
- 10-30 50-70 85-105
- Cellular Location
- Cell membrane
- Gene sequence
- Not Available
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID Q56408 UniProtKB Entry Name COX1_THETH GenBank Protein ID 2765670 GenBank Gene ID Z84206 PDB ID(s) 1XME - General References
- Serganov A, Rak A, Garber M, Reinbolt J, Ehresmann B, Ehresmann C, Grunberg-Manago M, Portier C: Ribosomal protein S15 from Thermus thermophilus--cloning, sequencing, overexpression of the gene and RNA-binding properties of the protein. Eur J Biochem. 1997 Jun 1;246(2):291-300. [Article]
Associated Data
- Drug Relations
Drug Drug group Pharmacological action? Type Actions Details B-nonylglucoside experimental unknown target Details