Cytochrome c oxidase subunit 2
Details
- Name
- Cytochrome c oxidase subunit 2
- Kind
- protein
- Synonyms
- 1.9.3.1
- ctaC
- Cytochrome c ba(3) subunit II
- Cytochrome c oxidase polypeptide II
- Cytochrome cba3 subunit 2
- Gene Name
- cbaB
- UniProtKB Entry
- P98052Swiss-Prot
- Organism
- Thermus thermophilus
- NCBI Taxonomy ID
- 274
- Amino acid sequence
>lcl|BSEQ0012720|Cytochrome c oxidase subunit 2 AYTLATHTAGVIPAGKLERVDPTTVRQEGPWADPAQAVVQTGPNQYTVYVLAFAFGYQPN PIEVPQGAEIVFKITSPDVIHGFHVEGTNINVEVLPGEVSTVRYTFKRPGEYRIICNQYC GLGHQNMFGTIVVKE
- Number of residues
- 135
- Molecular Weight
- 14803.78
- Theoretical pI
- 6.08
- GO Classification
- Functionscopper ion binding / cytochrome-c oxidase activityComponentsintegral component of membrane / plasma membrane / respiratory chain
- General Function
- Subunits I and II form the functional core of the enzyme complex. Electrons originating in cytochrome c are transferred via heme a and Cu(A) to the binuclear center formed by heme a3 and Cu(B).
- Specific Function
- copper ion binding
- Pfam Domain Function
- COX2 (PF00116)
- Signal Regions
- Not Available
- Transmembrane Regions
- Not Available
- Cellular Location
- Cell membrane
- Gene sequence
- Not Available
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P98052 UniProtKB Entry Name COX2_THETH PDB ID(s) 1XME, 2CUA, 2FWL, 2LLN - General References
- Williams PA, Blackburn NJ, Sanders D, Bellamy H, Stura EA, Fee JA, McRee DE: The CuA domain of Thermus thermophilus ba3-type cytochrome c oxidase at 1.6 A resolution. Nat Struct Biol. 1999 Jun;6(6):509-16. [Article]
Associated Data
- Drug Relations
Drug Drug group Pharmacological action? Type Actions Details B-nonylglucoside experimental unknown target Details