Porin
Details
- Name
- Porin
- Kind
- protein
- Synonyms
- Not Available
- Gene Name
- Not Available
- UniProtKB Entry
- P31243Swiss-Prot
- Organism
- Rhodobacter capsulatus
- NCBI Taxonomy ID
- 1061
- Amino acid sequence
>lcl|BSEQ0017285|Porin EVKLSGDARMGVMYNGDDWNFSSRSRVLFTMSGTTDSGLEFGASFKAHESVGAETGEDGT VFLSGAFGKIEMGDALGASEALFGDLYEVGYTDLDDRGGNDIPYLTGDERLTAEDNPVLL YTYSAGAFSVAASMSDGKVGETSEDDAQEMAVAAAYTFGNYTVGLGYEKIDSPDTALMAD MEQLELAAIAKFGATNVKAYYADGELDRDFARAVFDLTPVAAAATAVDHKAYGLSVDSTF GATTVGGYVQVLDIDTIDDVTYYGLGASYDLGGGASIVGGIADNDLPNSDMVADLGVKFK F
- Number of residues
- 301
- Molecular Weight
- 31536.27
- Theoretical pI
- 3.75
- GO Classification
- Functionsporin activityProcessesion transportComponentscell outer membrane / pore complex
- General Function
- Forms channels that allow the passive diffusion of small hydrophilic solutes up to an exclusion limit of about 0.6 kDa.
- Specific Function
- porin activity
- Pfam Domain Function
- Not Available
- Signal Regions
- Not Available
- Transmembrane Regions
- Not Available
- Cellular Location
- Cell outer membrane
- Gene sequence
- Not Available
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P31243 UniProtKB Entry Name PORI_RHOCA PDB ID(s) 2POR, 3POR - General References
- Schiltz E, Kreusch A, Nestel U, Schulz GE: Primary structure of porin from Rhodobacter capsulatus. Eur J Biochem. 1991 Aug 1;199(3):587-94. [Article]
- Weiss MS, Wacker T, Weckesser J, Welte W, Schulz GE: The three-dimensional structure of porin from Rhodobacter capsulatus at 3 A resolution. FEBS Lett. 1990 Jul 16;267(2):268-72. [Article]
- Weiss MS, Kreusch A, Schiltz E, Nestel U, Welte W, Weckesser J, Schulz GE: The structure of porin from Rhodobacter capsulatus at 1.8 A resolution. FEBS Lett. 1991 Mar 25;280(2):379-82. [Article]
- Weiss MS, Schulz GE: Structure of porin refined at 1.8 A resolution. J Mol Biol. 1992 Sep 20;227(2):493-509. [Article]
Associated Data
- Drug Relations
Drug Drug group Pharmacological action? Type Actions Details (Hydroxyethyloxy)Tri(Ethyloxy)Octane experimental unknown target Details