Immunoglobulin lambda variable 7-43
Details
- Name
- Immunoglobulin lambda variable 7-43
- Kind
- protein
- Synonyms
- Ig lambda chain V region 4A
- Gene Name
- IGLV7-43
- UniProtKB Entry
- P04211Swiss-Prot
- Organism
- Humans
- NCBI Taxonomy ID
- 9606
- Amino acid sequence
>lcl|BSEQ0064642|Immunoglobulin lambda variable 7-43 MAWTPLFLFLLTCCPGSNSQTVVTQEPSLTVSPGGTVTLTCASSTGAVTSGYYPNWFQQK PGQAPRALIYSTSNKHSWTPARFSGSLLGGKAALTLSGVQPEDEAEYYCLLYYGGAQ
- Number of residues
- 117
- Molecular Weight
- 12450.93
- Theoretical pI
- 7.12
- GO Classification
- Functionsantigen bindingProcessesimmune responseComponentsextracellular region / plasma membrane
- General Function
- V region of the variable domain of immunoglobulin light chains that participates in the antigen recognition (PubMed:24600447). Immunoglobulins, also known as antibodies, are membrane-bound or secreted glycoproteins produced by B lymphocytes. In the recognition phase of humoral immunity, the membrane-bound immunoglobulins serve as receptors which, upon binding of a specific antigen, trigger the clonal expansion and differentiation of B lymphocytes into immunoglobulins-secreting plasma cells. Secreted immunoglobulins mediate the effector phase of humoral immunity, which results in the elimination of bound antigens (PubMed:20176268, PubMed:22158414). The antigen binding site is formed by the variable domain of one heavy chain, together with that of its associated light chain. Thus, each immunoglobulin has two antigen binding sites with remarkable affinity for a particular antigen. The variable domains are assembled by a process called V-(D)-J rearrangement and can then be subjected to somatic hypermutations which, after exposure to antigen and selection, allow affinity maturation for a particular antigen (PubMed:17576170, PubMed:20176268)
- Specific Function
- antigen binding
- Pfam Domain Function
- V-set (PF07686)
- Signal Regions
- 1-19
- Transmembrane Regions
- Not Available
- Cellular Location
- Secreted
- Gene sequence
- Not Available
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P04211 UniProtKB Entry Name LV743_HUMAN GeneCard ID IGLV7-43 HGNC ID HGNC:5929 - General References
- Anderson ML, Szajnert MF, Kaplan JC, McColl L, Young BD: The isolation of a human Ig V lambda gene from a recombinant library of chromosome 22 and estimation of its copy number. Nucleic Acids Res. 1984 Sep 11;12(17):6647-61. [Article]
Associated Data
- Drug Relations
Drug Drug group Pharmacological action? Type Actions Details 4-HYDROXY-5-IODO-3-NITROPHENYLACETYL-EPSILON-AMINOCAPROIC ACID ANION experimental unknown target Details 4-HYDROXY-3-NITROPHENYLACETYL-EPSILON-AMINOCAPROIC ACID ANION experimental unknown target Details