Cholix toxin
Details
- Name
- Cholix toxin
- Kind
- protein
- Synonyms
- 2.4.2.36
- Exotoxin A
- NAD(+)--diphthamide ADP-ribosyltransferase
- toxA
- Gene Name
- chxA
- UniProtKB Entry
- Q5EK40Swiss-Prot
- Organism
- Vibrio cholerae
- NCBI Taxonomy ID
- 666
- Amino acid sequence
>lcl|BSEQ0012985|Cholix toxin MYLTFYLEKVMKKMLLIAGATVISSMAHPTFAVEDELNIFDECRSPCSLTPEPGKPIQSK LSIPSDVVLDEGVLYYSMTINDEQNDIKDEDKGESIITIGEFATVRATRHYVNQDAPFGV IHLDITTENGTKTYSYNRKEGEFAINWLVPIGEDSPASIKISVDELDQQRNIIEVPKLYS IDLDNQTLEQWKTQGNVSFSVTRPEHNIAISWPSVSYKAAQKEGSRHKRWAHWHTGLALC WLVPMDAIYNYITQQNCTLGDNWFGGSYETVAGTPKVITVKQGIEQKPVEQRIHFSKGNA MSALAAHRVCGVPLETLARSRKPRDLTDDLSCAYQAQNIVSLFVATRILFSHLDSVFTLN LDEQEPEVAERLSDLRRINENNPGMVTQVLTVARQIYNDYVTHHPGLTPEQTSAGAQAAD ILSLFCPDADKSCVASNNDQANINIESRSGRSYLPENRAVITPQGVTNWTYQELEATHQA LTREGYVFVGYHGTNHVAAQTIVNRIAPVPRGNNTENEEKWGGLYVATHAEVAHGYARIK EGTGEYGLPTRAERDARGVMLRVYIPRASLERFYRTNTPLENAEEHITQVIGHSLPLRNE AFTGPESAGGEDETVIGWDMAIHAVAIPSTIPGNAYEELAIDEEAVAKEQSISTKPPYKE RKDELK
- Number of residues
- 666
- Molecular Weight
- 74292.735
- Theoretical pI
- 5.06
- GO Classification
- FunctionsNAD+-diphthamide ADP-ribosyltransferase activity
- General Function
- An NAD-dependent ADP-ribosyltransferase (ADPRT), it catalyzes the transfer of the ADP-ribosyl moiety of oxidized NAD onto eukaryotic elongation factor 2 (eEF-2) thus arresting protein synthesis. It probably uses the eukaryotic prolow-density lipoprotein receptor-related protein 1 (LRP1) to enter mouse cells, although there seems to be at least one other receptor as well. Is active against mouse fibroblasts, Chinese hamster ovary eEF-2, brine shrimp (Artemia spp. nauplii) and upon expression in S.cerevisiae.
- Specific Function
- NAD+-diphthamide ADP-ribosyltransferase activity
- Pfam Domain Function
- Signal Regions
- 1-32
- Transmembrane Regions
- Not Available
- Cellular Location
- Not Available
- Gene sequence
- Not Available
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID Q5EK40 UniProtKB Entry Name CHXA_VIBCL GenBank Protein ID 58615287 GenBank Gene ID AY876053 PDB ID(s) 2Q5T, 2Q6M, 3ESS, 3KI0, 3KI1, 3KI2, 3KI3, 3KI4, 3KI5, 3KI6, 3KI7, 3NY6, 3Q9O - General References
- Purdy A, Rohwer F, Edwards R, Azam F, Bartlett DH: A glimpse into the expanded genome content of Vibrio cholerae through identification of genes present in environmental strains. J Bacteriol. 2005 May;187(9):2992-3001. [Article]
- Jorgensen R, Purdy AE, Fieldhouse RJ, Kimber MS, Bartlett DH, Merrill AR: Cholix toxin, a novel ADP-ribosylating factor from Vibrio cholerae. J Biol Chem. 2008 Apr 18;283(16):10671-8. doi: 10.1074/jbc.M710008200. Epub 2008 Feb 14. [Article]
- Turgeon Z, White D, Jorgensen R, Visschedyk D, Fieldhouse RJ, Mangroo D, Merrill AR: Yeast as a tool for characterizing mono-ADP-ribosyltransferase toxins. FEMS Microbiol Lett. 2009 Nov;300(1):97-106. doi: 10.1111/j.1574-6968.2009.01777.x. Epub 2009 Aug 31. [Article]
- Turgeon Z, Jorgensen R, Visschedyk D, Edwards PR, Legree S, McGregor C, Fieldhouse RJ, Mangroo D, Schapira M, Merrill AR: Newly discovered and characterized antivirulence compounds inhibit bacterial mono-ADP-ribosyltransferase toxins. Antimicrob Agents Chemother. 2011 Mar;55(3):983-91. doi: 10.1128/AAC.01164-10. Epub 2010 Dec 6. [Article]
Associated Data
- Drug Relations
Drug Drug group Pharmacological action? Type Actions Details N~2~,N~2~-DIMETHYL-N~1~-(6-OXO-5,6-DIHYDROPHENANTHRIDIN-2-YL)GLYCINAMIDE experimental unknown target Details