Thiostrepton
Details
- Name
- Thiostrepton
- Kind
- protein
- Synonyms
- Alaninamide
- Bryamycin
- Gargon
- Thiactin
- Gene Name
- tpdA
- UniProtKB Entry
- P0C8P8Swiss-Prot
- Organism
- Streptomyces azureus
- NCBI Taxonomy ID
- 146537
- Amino acid sequence
>lcl|BSEQ0013017|Thiostrepton MDATAIHERWSVMSNASIGQEIGVEGLTGLDVDALEISDYVDETLLDGEDLTVTMIASAS CTTCICTCSCSS
- Number of residues
- 72
- Molecular Weight
- 7550.295
- Theoretical pI
- 5.63
- GO Classification
- Processesdefense response to bacteriumComponentsextracellular region
- General Function
- Has bacteriocidal activity. Inhibits bacterial protein biosynthesis by acting on the elongation factor Tu (EF-Tu) (By similarity).
- Specific Function
- Not Available
- Pfam Domain Function
- Not Available
- Signal Regions
- Not Available
- Transmembrane Regions
- Not Available
- Cellular Location
- Secreted
- Gene sequence
- Not Available
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P0C8P8 UniProtKB Entry Name THCL_STRAJ PDB ID(s) 1E9W, 1OLN, 2JQ7, 2L2W, 2L2X, 2L2Y, 2L2Z, 3CF5, 4HP2 - General References
- Morris RP, Leeds JA, Naegeli HU, Oberer L, Memmert K, Weber E, LaMarche MJ, Parker CN, Burrer N, Esterow S, Hein AE, Schmitt EK, Krastel P: Ribosomally synthesized thiopeptide antibiotics targeting elongation factor Tu. J Am Chem Soc. 2009 Apr 29;131(16):5946-55. doi: 10.1021/ja900488a. [Article]
- DONOVICK R, PAGANO JF, STOUT HA, WEINSTEIN MJ: Thiostrepton, a new antibiotic. I. In vitro studies. Antibiot Annu. 1955-1956;3:554-9. [Article]
- DUTCHER JD, VANDEPUTTE J: Thiostrepton, a new antibiotic. II. Isolation and chemical characterization. Antibiot Annu. 1955-1956;3:560-1. [Article]
- JAMBOR WP, STEINBERG BA, SUYDAM LO: Thiostrepton, a new antibiotic. III. In vivo studies. Antibiot Annu. 1955-1956;3:562-5. [Article]
- Priestley ND, Smith TM, Shipley PR, Floss HG: Studies on the biosynthesis of thiostrepton: 4-(1-hydroxyethyl)quinoline-2-carboxylate as a free intermediate on the pathway to the quinaldic acid moiety. Bioorg Med Chem. 1996 Jul;4(7):1135-47. [Article]
- Nicolaou KC, Safina BS, Zak M, Lee SH, Nevalainen M, Bella M, Estrada AA, Funke C, Zecri FJ, Bulat S: Total synthesis of thiostrepton. Retrosynthetic analysis and construction of key building blocks. J Am Chem Soc. 2005 Aug 10;127(31):11159-75. [Article]
- Nicolaou KC, Zak M, Safina BS, Estrada AA, Lee SH, Nevalainen M: Total synthesis of thiostrepton. Assembly of key building blocks and completion of the synthesis. J Am Chem Soc. 2005 Aug 10;127(31):11176-83. [Article]
- Hensens OD, Albers-Schonberg G, Anderson BF: The solution conformation of the peptide antibiotic thiostrepton: a 1H NMR study. J Antibiot (Tokyo). 1983 Jul;36(7):799-813. [Article]
- Hensens OD, Albers-Schonberg G: 13C NMR study of thiostrepton and thiopeptin components. J Antibiot (Tokyo). 1983 Jul;36(7):832-45. [Article]
- Bond CS, Shaw MP, Alphey MS, Hunter WN: Structure of the macrocycle thiostrepton solved using the anomalous dispersion contribution of sulfur. Acta Crystallogr D Biol Crystallogr. 2001 May;57(Pt 5):755-8. Epub 2001 Apr 24. [Article]
Associated Data
- Drug Relations
Drug Drug group Pharmacological action? Type Actions Details 8-Hydroxy-4-(1-Hydroxyethyl)Quinoline-2-Carboxylic Acid experimental unknown target Details (4s)-2-[(1e)-1-Aminoprop-1-Enyl]-4,5-Dihydro-1,3-Thiazole-4-Carboxylic Acid experimental unknown target Details