Secreted chorismate mutase
Details
- Name
- Secreted chorismate mutase
- Kind
- protein
- Synonyms
- *MtCM
- 5.4.99.5
- Gene Name
- Not Available
- UniProtKB Entry
- P9WIB9Swiss-Prot
- Organism
- Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
- NCBI Taxonomy ID
- 83332
- Amino acid sequence
>lcl|BSEQ0051276|Secreted chorismate mutase MLTRPREIYLATAVSIGILLSLIAPLGPPLARADGTSQLAELVDAAAERLEVADPVAAFK WRAQLPIEDSGRVEQQLAKLGEDARSQHIDPDYVTRVFDDQIRATEAIEYSRFSDWKLNP ASAPPEPPDLSASRSAIDSLNNRMLSQIWSHWSLLSAPSCAAQLDRAKRDIVRSRHLDSL YQRALTTATQSYCQALPPA
- Number of residues
- 199
- Molecular Weight
- 21944.46
- Theoretical pI
- Not Available
- GO Classification
- Functionschorismate mutase activityProcesseschorismate metabolic processComponentsextracellular region
- General Function
- Catalyzes the Claisen rearrangement of chorismate to prephenate. May play some role in the pathogenicity.
- Specific Function
- chorismate mutase activity
- Pfam Domain Function
- CM_2 (PF01817)
- Signal Regions
- 1-33
- Transmembrane Regions
- Not Available
- Cellular Location
- Secreted
- Gene sequence
>lcl|BSEQ0051277|Secreted chorismate mutase TTGCTTACCCGTCCACGTGAGATATACCTCGCGACCGCCGTCTCGATCGGCATCCTGTTG TCGCTGATTGCACCACTAGGCCCCCCGCTGGCGCGAGCCGACGGCACCAGCCAGTTAGCC GAGTTGGTCGACGCCGCCGCTGAGCGGTTGGAGGTCGCCGACCCGGTGGCAGCCTTCAAG TGGCGTGCTCAGCTGCCCATTGAGGATTCCGGCCGAGTCGAACAGCAACTCGCAAAGTTG GGCGAAGATGCCCGCTCGCAGCACATCGACCCCGACTACGTCACCCGCGTCTTCGACGAC CAGATTCGCGCCACCGAGGCAATCGAGTACAGCCGGTTCTCGGACTGGAAGCTCAACCCG GCCAGCGCGCCCCCGGAGCCGCCGGATCTATCGGCATCGCGATCGGCGATCGACTCCCTG AATAATCGGATGCTGTCGCAGATTTGGAGTCACTGGAGTTTGCTGTCCGCGCCGTCCTGC GCCGCCCAACTCGACCGCGCCAAACGCGACATAGTGCGGTCCCGCCACCTCGATAGCCTC TATCAACGGGCCCTGACGACAGCAACACAGTCGTATTGCCAGGCCCTACCGCCGGCCTGA
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P9WIB9 UniProtKB Entry Name SCMU_MYCTU PDB ID(s) 2AO2, 2F6L, 2FP1, 2FP2 KEGG ID mtu:Rv1885c NCBI Gene ID 885772 - General References
- Cole ST, Brosch R, Parkhill J, Garnier T, Churcher C, Harris D, Gordon SV, Eiglmeier K, Gas S, Barry CE 3rd, Tekaia F, Badcock K, Basham D, Brown D, Chillingworth T, Connor R, Davies R, Devlin K, Feltwell T, Gentles S, Hamlin N, Holroyd S, Hornsby T, Jagels K, Krogh A, McLean J, Moule S, Murphy L, Oliver K, Osborne J, Quail MA, Rajandream MA, Rogers J, Rutter S, Seeger K, Skelton J, Squares R, Squares S, Sulston JE, Taylor K, Whitehead S, Barrell BG: Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence. Nature. 1998 Jun 11;393(6685):537-44. [Article]
- Sasso S, Ramakrishnan C, Gamper M, Hilvert D, Kast P: Characterization of the secreted chorismate mutase from the pathogen Mycobacterium tuberculosis. FEBS J. 2005 Jan;272(2):375-89. [Article]
- Prakash P, Aruna B, Sardesai AA, Hasnain SE: Purified recombinant hypothetical protein coded by open reading frame Rv1885c of Mycobacterium tuberculosis exhibits a monofunctional AroQ class of periplasmic chorismate mutase activity. J Biol Chem. 2005 May 20;280(20):19641-8. Epub 2005 Feb 28. [Article]
- Kelkar DS, Kumar D, Kumar P, Balakrishnan L, Muthusamy B, Yadav AK, Shrivastava P, Marimuthu A, Anand S, Sundaram H, Kingsbury R, Harsha HC, Nair B, Prasad TS, Chauhan DS, Katoch K, Katoch VM, Kumar P, Chaerkady R, Ramachandran S, Dash D, Pandey A: Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry. Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3. [Article]
- Okvist M, Dey R, Sasso S, Grahn E, Kast P, Krengel U: 1.6 A crystal structure of the secreted chorismate mutase from Mycobacterium tuberculosis: novel fold topology revealed. J Mol Biol. 2006 Apr 14;357(5):1483-99. Epub 2006 Feb 6. [Article]
- Qamra R, Prakash P, Aruna B, Hasnain SE, Mande SC: The 2.15 A crystal structure of Mycobacterium tuberculosis chorismate mutase reveals an unexpected gene duplication and suggests a role in host-pathogen interactions. Biochemistry. 2006 Jun 13;45(23):6997-7005. [Article]
- Kim SK, Reddy SK, Nelson BC, Vasquez GB, Davis A, Howard AJ, Patterson S, Gilliland GL, Ladner JE, Reddy PT: Biochemical and structural characterization of the secreted chorismate mutase (Rv1885c) from Mycobacterium tuberculosis H37Rv: an *AroQ enzyme not regulated by the aromatic amino acids. J Bacteriol. 2006 Dec;188(24):8638-48. [Article]
- Raman K, Yeturu K, Chandra N: targetTB: a target identification pipeline for Mycobacterium tuberculosis through an interactome, reactome and genome-scale structural analysis. BMC Syst Biol. 2008 Dec 19;2:109. doi: 10.1186/1752-0509-2-109. [Article]
Associated Data
- Drug Relations
Drug Drug group Pharmacological action? Type Actions Details 8-Hydroxy-2-oxa-bicyclo[3.3.1]non-6-ene-3,5-dicarboxylic acid experimental unknown target Details