Immunoglobulin heavy constant mu

Details

Name
Immunoglobulin heavy constant mu
Kind
protein
Synonyms
  • Ig mu chain C region
  • Ig mu chain C region BOT
  • Ig mu chain C region GAL
  • Ig mu chain C region OU
Gene Name
IGHM
UniProtKB Entry
P01871Swiss-Prot
Organism
Humans
NCBI Taxonomy ID
9606
Amino acid sequence
>lcl|BSEQ0055481|Immunoglobulin heavy constant mu
GSASAPTLFPLVSCENSPSDTSSVAVGCLAQDFLPDSITFSWKYKNNSDISSTRGFPSVL
RGGKYAATSQVLLPSKDVMQGTDEHVVCKVQHPNGNKEKNVPLPVIAELPPKVSVFVPPR
DGFFGNPRKSKLICQATGFSPRQIQVSWLREGKQVGSGVTTDQVQAEAKESGPTTYKVTS
TLTIKESDWLGQSMFTCRVDHRGLTFQQNASSMCVPDQDTAIRVFAIPPSFASIFLTKST
KLTCLVTDLTTYDSVTISWTRQNGEAVKTHTNISESHPNATFSAVGEASICEDDWNSGER
FTCTVTHTDLPSPLKQTISRPKGVALHRPDVYLLPPAREQLNLRESATITCLVTGFSPAD
VFVQWMQRGQPLSPEKYVTSAPMPEPQAPGRYFAHSILTVSEEEWNTGETYTCVVAHEAL
PNRVTERTVDKSTEGEVSADEEGFENLWATASTFIVLFLLSLFYSTTVTLFKVK
Number of residues
474
Molecular Weight
51923.145
Theoretical pI
Not Available
GO Classification
Processes
pre-B cell allelic exclusion
Components
IgM B cell receptor complex / IgM immunoglobulin complex / immunoglobulin complex, circulating
General Function
Constant region of immunoglobulin heavy chains. Immunoglobulins, also known as antibodies, are membrane-bound or secreted glycoproteins produced by B lymphocytes. In the recognition phase of humoral immunity, the membrane-bound immunoglobulins serve as receptors which, upon binding of a specific antigen, trigger the clonal expansion and differentiation of B lymphocytes into immunoglobulins-secreting plasma cells. Secreted immunoglobulins mediate the effector phase of humoral immunity, which results in the elimination of bound antigens (PubMed:20176268, PubMed:22158414). The antigen binding site is formed by the variable domain of one heavy chain, together with that of its associated light chain. Thus, each immunoglobulin has two antigen binding sites with remarkable affinity for a particular antigen. The variable domains are assembled by a process called V-(D)-J rearrangement and can then be subjected to somatic hypermutations which, after exposure to antigen and selection, allow affinity maturation for a particular antigen (PubMed:17576170, PubMed:20176268)
Specific Function
Antigen binding
Pfam Domain Function
Signal Regions
Not Available
Transmembrane Regions
451-471
Cellular Location
Secreted
Gene sequence
Not Available
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP01871
UniProtKB Entry NameIGHM_HUMAN
GeneCard IDIGHM
HGNC IDHGNC:5541
PDB ID(s)1HEZ, 2AGJ, 2RCJ, 6KXS, 7K0C, 7QDO, 7WSP, 7XQ8, 7XT6, 7Y09, 7Y0H, 7Y0J, 7YG2, 7YSG, 7YTC, 7YTD, 8ADY, 8ADZ, 8AE0, 8AE2, 8AE3, 8BPF, 8BPG, 8GZN
General References
  1. Dorai H, Gillies SD: The complete nucleotide sequence of a human immunoglobulin genomic C mu gene. Nucleic Acids Res. 1989 Aug 11;17(15):6412. [Article]
  2. Friedlander RM, Nussenzweig MC, Leder P: Complete nucleotide sequence of the membrane form of the human IgM heavy chain. Nucleic Acids Res. 1990 Jul 25;18(14):4278. [Article]
  3. Watanabe S, Barnikol HU, Horn J, Bertram J, Hilschmann N: [The primary structure of a monoclonal IgM-immunoglobulin (macroglobulin Gal.), II: the amino acid sequence of the H-chain (mu-type), subgroup H III. Architecture of the complete IgM-molecule (author's transl)]. Hoppe Seylers Z Physiol Chem. 1973 Oct-Nov;354(10-11):1505-9. [Article]
  4. Mihaesco E, Barnikol-Watanabe S, Barnikol HU, Mihaesco C, Hilschmann N: The primary structure of the constant part of mu-chain-disease protein BOT. Eur J Biochem. 1980 Oct;111(1):275-86. [Article]
  5. Putnam FW, Florent G, Paul C, Shinoda T, Shimizu A: Complete amino acid sequence of the Mu heavy chain of a human IgM immunoglobulin. Science. 1973 Oct 19;182(4109):287-91. [Article]
  6. Dolby TW, Devuono J, Croce CM: Cloning and partial nucleotide sequence of human immunoglobulin mu chain cDNA from B cells and mouse-human hybridomas. Proc Natl Acad Sci U S A. 1980 Oct;77(10):6027-31. [Article]
  7. Rabbitts TH, Forster A, Milstein CP: Human immunoglobulin heavy chain genes: evolutionary comparisons of C mu, C delta and C gamma genes and associated switch sequences. Nucleic Acids Res. 1981 Sep 25;9(18):4509-24. [Article]
  8. Tisch R, Roifman CM, Hozumi N: Functional differences between immunoglobulins M and D expressed on the surface of an immature B-cell line. Proc Natl Acad Sci U S A. 1988 Sep;85(18):6914-8. [Article]
  9. Yel L, Minegishi Y, Coustan-Smith E, Buckley RH, Trubel H, Pachman LM, Kitchingman GR, Campana D, Rohrer J, Conley ME: Mutations in the mu heavy-chain gene in patients with agammaglobulinemia. N Engl J Med. 1996 Nov 14;335(20):1486-93. [Article]
  10. Geisberger R, Lamers M, Achatz G: The riddle of the dual expression of IgM and IgD. Immunology. 2006 Aug;118(4):429-37. [Article]
  11. Bunkenborg J, Pilch BJ, Podtelejnikov AV, Wisniewski JR: Screening for N-glycosylated proteins by liquid chromatography mass spectrometry. Proteomics. 2004 Feb;4(2):454-65. [Article]
  12. Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res. 2009 Feb;8(2):651-61. doi: 10.1021/pr8008012. [Article]
  13. Jia W, Lu Z, Fu Y, Wang HP, Wang LH, Chi H, Yuan ZF, Zheng ZB, Song LN, Han HH, Liang YM, Wang JL, Cai Y, Zhang YK, Deng YL, Ying WT, He SM, Qian XH: A strategy for precise and large scale identification of core fucosylated glycoproteins. Mol Cell Proteomics. 2009 May;8(5):913-23. doi: 10.1074/mcp.M800504-MCP200. Epub 2009 Jan 12. [Article]
  14. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. [Article]
  15. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. [Article]

Associated Data

Drug Relations
DrugDrug groupPharmacological action?TypeActionsDetails
Zincapproved, investigationalunknowntargetDetails
Zinc acetateapproved, investigationalunknowntargetDetails