Fibroblast growth factor 19

Details

Name
Fibroblast growth factor 19
Kind
protein
Synonyms
  • FGF-19
Gene Name
FGF19
UniProtKB Entry
O95750Swiss-Prot
Organism
Humans
NCBI Taxonomy ID
9606
Amino acid sequence
>lcl|BSEQ0021469|Fibroblast growth factor 19
MRSGCVVVHVWILAGLWLAVAGRPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFL
RIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDC
AFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLR
GHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK
Number of residues
216
Molecular Weight
24002.345
Theoretical pI
Not Available
GO Classification
Functions
fibroblast growth factor receptor binding
Processes
fibroblast growth factor receptor signaling pathway / negative regulation of bile acid biosynthetic process / negative regulation of gene expression / nervous system development / positive regulation of ERK1 and ERK2 cascade / positive regulation of glucose import / positive regulation of JNK cascade / positive regulation of protein phosphorylation
Components
extracellular region
General Function
Involved in the suppression of bile acid biosynthesis through down-regulation of CYP7A1 expression, following positive regulation of the JNK and ERK1/2 cascades. Stimulates glucose uptake in adipocytes. Activity requires the presence of KLB and FGFR4
Specific Function
Fibroblast growth factor receptor binding
Pfam Domain Function
Signal Regions
1-24
Transmembrane Regions
Not Available
Cellular Location
Secreted
Gene sequence
>lcl|BSEQ0021470|Fibroblast growth factor 19 (FGF19)
ATGCGGAGCGGGTGTGTGGTGGTCCACGTATGGATCCTGGCCGGCCTCTGGCTGGCCGTG
GCCGGGCGCCCCCTCGCCTTCTCGGACGCGGGGCCCCACGTGCACTACGGCTGGGGCGAC
CCCATCCGCCTGCGGCACCTGTACACCTCCGGCCCCCACGGGCTCTCCAGCTGCTTCCTG
CGCATCCGTGCCGACGGCGTCGTGGACTGCGCGCGGGGCCAGAGCGCGCACAGTTTGCTG
GAGATCAAGGCAGTCGCTCTGCGGACCGTGGCCATCAAGGGCGTGCACAGCGTGCGGTAC
CTCTGCATGGGCGCCGACGGCAAGATGCAGGGGCTGCTTCAGTACTCGGAGGAAGACTGT
GCTTTCGAGGAGGAGATCCGCCCAGATGGCTACAATGTGTACCGATCCGAGAAGCACCGC
CTCCCGGTCTCCCTGAGCAGTGCCAAACAGCGGCAGCTGTACAAGAACAGAGGCTTTCTT
CCACTCTCTCATTTCCTGCCCATGCTGCCCATGGTCCCAGAGGAGCCTGAGGACCTCAGG
GGCCACTTGGAATCTGACATGTTCTCTTCGCCCCTGGAGACCGACAGCATGGACCCATTT
GGGCTTGTCACCGGACTGGAGGCCGTGAGGAGTCCCAGCTTTGAGAAGTAA
Chromosome Location
11
Locus
11q13.3
External Identifiers
ResourceLink
UniProtKB IDO95750
UniProtKB Entry NameFGF19_HUMAN
GeneCard IDFGF19
HGNC IDHGNC:3675
PDB ID(s)1PWA, 2P23, 6KTR, 6NFJ
KEGG IDhsa:9965
NCBI Gene ID9965
General References
  1. Nishimura T, Utsunomiya Y, Hoshikawa M, Ohuchi H, Itoh N: Structure and expression of a novel human FGF, FGF-19, expressed in the fetal brain. Biochim Biophys Acta. 1999 Jan 18;1444(1):148-51. [Article]
  2. Xie MH, Holcomb I, Deuel B, Dowd P, Huang A, Vagts A, Foster J, Liang J, Brush J, Gu Q, Hillan K, Goddard A, Gurney AL: FGF-19, a novel fibroblast growth factor with unique specificity for FGFR4. Cytokine. 1999 Oct;11(10):729-35. [Article]
  3. Clark HF, Gurney AL, Abaya E, Baker K, Baldwin D, Brush J, Chen J, Chow B, Chui C, Crowley C, Currell B, Deuel B, Dowd P, Eaton D, Foster J, Grimaldi C, Gu Q, Hass PE, Heldens S, Huang A, Kim HS, Klimowski L, Jin Y, Johnson S, Lee J, Lewis L, Liao D, Mark M, Robbie E, Sanchez C, Schoenfeld J, Seshagiri S, Simmons L, Singh J, Smith V, Stinson J, Vagts A, Vandlen R, Watanabe C, Wieand D, Woods K, Xie MH, Yansura D, Yi S, Yu G, Yuan J, Zhang M, Zhang Z, Goddard A, Wood WI, Godowski P, Gray A: The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment. Genome Res. 2003 Oct;13(10):2265-70. Epub 2003 Sep 15. [Article]
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
  5. Zhang Z, Henzel WJ: Signal peptide prediction based on analysis of experimentally verified cleavage sites. Protein Sci. 2004 Oct;13(10):2819-24. Epub 2004 Aug 31. [Article]
  6. Holt JA, Luo G, Billin AN, Bisi J, McNeill YY, Kozarsky KF, Donahee M, Wang DY, Mansfield TA, Kliewer SA, Goodwin B, Jones SA: Definition of a novel growth factor-dependent signal cascade for the suppression of bile acid biosynthesis. Genes Dev. 2003 Jul 1;17(13):1581-91. Epub 2003 Jun 18. [Article]
  7. Zhang X, Ibrahimi OA, Olsen SK, Umemori H, Mohammadi M, Ornitz DM: Receptor specificity of the fibroblast growth factor family. The complete mammalian FGF family. J Biol Chem. 2006 Jun 9;281(23):15694-700. Epub 2006 Apr 4. [Article]
  8. Kurosu H, Choi M, Ogawa Y, Dickson AS, Goetz R, Eliseenkova AV, Mohammadi M, Rosenblatt KP, Kliewer SA, Kuro-o M: Tissue-specific expression of betaKlotho and fibroblast growth factor (FGF) receptor isoforms determines metabolic activity of FGF19 and FGF21. J Biol Chem. 2007 Sep 14;282(37):26687-95. Epub 2007 Jul 10. [Article]
  9. Wu X, Lemon B, Li X, Gupte J, Weiszmann J, Stevens J, Hawkins N, Shen W, Lindberg R, Chen JL, Tian H, Li Y: C-terminal tail of FGF19 determines its specificity toward Klotho co-receptors. J Biol Chem. 2008 Nov 28;283(48):33304-9. doi: 10.1074/jbc.M803319200. Epub 2008 Oct 1. [Article]
  10. Song KH, Li T, Owsley E, Strom S, Chiang JY: Bile acids activate fibroblast growth factor 19 signaling in human hepatocytes to inhibit cholesterol 7alpha-hydroxylase gene expression. Hepatology. 2009 Jan;49(1):297-305. doi: 10.1002/hep.22627. [Article]
  11. Turner N, Grose R: Fibroblast growth factor signalling: from development to cancer. Nat Rev Cancer. 2010 Feb;10(2):116-29. doi: 10.1038/nrc2780. [Article]
  12. Harmer NJ, Pellegrini L, Chirgadze D, Fernandez-Recio J, Blundell TL: The crystal structure of fibroblast growth factor (FGF) 19 reveals novel features of the FGF family and offers a structural basis for its unusual receptor affinity. Biochemistry. 2004 Jan 27;43(3):629-40. [Article]
  13. Goetz R, Beenken A, Ibrahimi OA, Kalinina J, Olsen SK, Eliseenkova AV, Xu C, Neubert TA, Zhang F, Linhardt RJ, Yu X, White KE, Inagaki T, Kliewer SA, Yamamoto M, Kurosu H, Ogawa Y, Kuro-o M, Lanske B, Razzaque MS, Mohammadi M: Molecular insights into the klotho-dependent, endocrine mode of action of fibroblast growth factor 19 subfamily members. Mol Cell Biol. 2007 May;27(9):3417-28. Epub 2007 Mar 5. [Article]

Associated Data

Drug Relations
DrugDrug groupPharmacological action?TypeActionsDetails
Heparinapproved, investigationalunknowntargetDetails