Glutathione S-transferase omega class
Details
- Name
- Glutathione S-transferase omega class
- Kind
- protein
- Synonyms
- Not Available
- Gene Name
- Not Available
- UniProtKB Entry
- K7YNB3TrEMBL
- Organism
- Fasciola hepatica
- NCBI Taxonomy ID
- 6192
- Amino acid sequence
>lcl|BSEQ0052096|Glutathione S-transferase omega class MHLKNGDPKPTIKPNQCTLFGFRFCPYVDRVRMVLQYYNVPHDNVWIHLYSKPDWYLELY PVGKVPLLITKEGKTIVESDAIIRYLDETIGNKSLMSLCGEAEFERAGKLASKLMAQSHG ILFGASVAEANASAYRDVCQEINDTIKGPYLLGDKLTLADFLLFSHVNHFEPIMARLDGL APSDVHDLKATDQYRTKWPRLTTFLDVMRRLPCVLTVREPSQKLALFAETYRQGQPNPDL
- Number of residues
- 240
- Molecular Weight
- 27333.315
- Theoretical pI
- Not Available
- GO Classification
- Functionsglutathione transferase activity
- General Function
- Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles.
- Specific Function
- glutathione dehydrogenase (ascorbate) activity
- Pfam Domain Function
- Not Available
- Signal Regions
- Not Available
- Transmembrane Regions
- Not Available
- Cellular Location
- Not Available
- Gene sequence
- Not Available
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID K7YNB3 UniProtKB Entry Name K7YNB3_FASHE - General References
- Morphew RM, Eccleston N, Wilkinson TJ, McGarry J, Perally S, Prescott M, Ward D, Williams D, Paterson S, Raman M, Ravikumar G, Khalid Saifullah M, Abbas Abidi SM, McVeigh P, Maule AG, Brophy PM, LaCourse EJ: Proteomics and in silico approaches to extend understanding of the glutathione transferase superfamily of the tropical liver fluke Fasciola gigantica. J Proteome Res. 2012 Dec 7;11(12):5876-89. doi: 10.1021/pr300654w. Epub 2012 Nov 28. [Article]
Associated Data
- Drug Relations
- Not Available