NADH-ubiquinone oxidoreductase chain 3
Details
- Name
- NADH-ubiquinone oxidoreductase chain 3
- Kind
- protein
- Synonyms
- 7.1.1.2
- NADH dehydrogenase subunit 3
- Gene Name
- ND3
- UniProtKB Entry
- Q34522Swiss-Prot
- Organism
- Fasciola hepatica
- NCBI Taxonomy ID
- 6192
- Amino acid sequence
>lcl|BSEQ0052097|NADH-ubiquinone oxidoreductase chain 3 MLFFAVLGLLFFLIFFLVLVFHAFLWNLDLGIFSGERSWVSSFECGFLSQRVTENYFSYT YFILLVFFVVFDLEVSLLLNMPLQGVLYKNFFSYLFFLVLLGIGFLVEVRRGYVRWAY
- Number of residues
- 118
- Molecular Weight
- 14031.585
- Theoretical pI
- Not Available
- GO Classification
- FunctionsNADH dehydrogenase (ubiquinone) activityComponentsintegral component of membrane / mitochondrial membrane / respirasome
- General Function
- Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).
- Specific Function
- NADH dehydrogenase (ubiquinone) activity
- Pfam Domain Function
- Oxidored_q4 (PF00507)
- Signal Regions
- Not Available
- Transmembrane Regions
- 1-21 59-79 86-106
- Cellular Location
- Mitochondrion membrane
- Gene sequence
- Not Available
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID Q34522 UniProtKB Entry Name NU3M_FASHE - General References
- Garey JR, Wolstenholme DR: Platyhelminth mitochondrial DNA: evidence for early evolutionary origin of a tRNA(serAGN) that contains a dihydrouridine arm replacement loop, and of serine-specifying AGA and AGG codons. J Mol Evol. 1989 May;28(5):374-87. [Article]
Associated Data
- Drug Relations
- Not Available