Prostaglandin E synthase
Details
- Name
- Prostaglandin E synthase
- Kind
- protein
- Synonyms
- 5.3.99.3
- Glutathione peroxidase PTGES
- Glutathione transferase PTGES
- MGST1-L1
- MGST1L1
- Microsomal glutathione S-transferase 1-like 1
- Microsomal prostaglandin E synthase 1
- MPGES-1
- MPGES1
- p53-induced gene 12 protein
- PGES
- PIG12
- Gene Name
- PTGES
- UniProtKB Entry
- O14684Swiss-Prot
- Organism
- Humans
- NCBI Taxonomy ID
- 9606
- Amino acid sequence
>lcl|BSEQ0019810|Prostaglandin E synthase MPAHSLVMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCR SDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGK LRAPIRSVTYTLAQLPCASMALQILWEAARHL
- Number of residues
- 152
- Molecular Weight
- 17102.135
- Theoretical pI
- Not Available
- GO Classification
- Not Available
- General Function
- Terminal enzyme of the cyclooxygenase (COX)-2-mediated prostaglandin E2 (PGE2) biosynthetic pathway. Catalyzes the glutathione-dependent oxidoreduction of prostaglandin endoperoxide H2 (PGH2) to prostaglandin E2 (PGE2) in response to inflammatory stimuli (PubMed:10377395, PubMed:10869354, PubMed:12244105, PubMed:12460774, PubMed:12672824, PubMed:18682561). Plays a key role in inflammation response, fever and pain (By similarity). Catalyzes also the oxidoreduction of endocannabinoids into prostaglandin glycerol esters and PGG2 into 15-hydroperoxy-PGE2 (PubMed:12244105, PubMed:12672824). In addition, displays low glutathione transferase and glutathione-dependent peroxidase activities, toward 1-chloro-2,4-dinitrobenzene and 5-hydroperoxyicosatetraenoic acid (5-HPETE), respectively (PubMed:12672824)
- Specific Function
- glutathione binding
- Pfam Domain Function
- MAPEG (PF01124)
- Signal Regions
- Not Available
- Transmembrane Regions
- 13-41 61-90 96-119 124-152
- Cellular Location
- Membrane
- Gene sequence
- Not Available
- Chromosome Location
- 9
- Locus
- 9q34.11
- External Identifiers
Resource Link UniProtKB ID O14684 UniProtKB Entry Name PTGES_HUMAN GeneCard ID PTGES HGNC ID HGNC:9599 PDB ID(s) 3DWW, 4AL0, 4AL1, 4BPM, 4WAB, 4YK5, 4YL0, 4YL1, 4YL3, 5BQG, 5BQH, 5BQI, 5K0I, 5T36, 5T37, 5TL9, 6VL4, 8PYV KEGG ID hsa:9536 IUPHAR/Guide To Pharmacology ID 1377 NCBI Gene ID 9536 - General References
- Not Available
Associated Data
- Drug Relations
Drug Drug group Pharmacological action? Type Actions Details Crisdesalazine investigational yes target inhibitor Details