Fructose-1,6-bisphosphatase isozyme 2
Details
- Name
- Fructose-1,6-bisphosphatase isozyme 2
- Kind
- protein
- Synonyms
- 3.1.3.11
- D-fructose-1,6-bisphosphate 1-phosphohydrolase 2
- FBPase 2
- Muscle FBPase
- Gene Name
- FBP2
- UniProtKB Entry
- O00757Swiss-Prot
- Organism
- Humans
- NCBI Taxonomy ID
- 9606
- Amino acid sequence
>lcl|BSEQ0054451|Fructose-1,6-bisphosphatase isozyme 2 MTDRSPFETDMLTLTRYVMEKGRQAKGTGELTQLLNSMLTAIKAISSAVRKAGLAHLYGI AGSVNVTGDEVKKLDVLSNSLVINMVQSSYSTCVLVSEENKDAIITAKEKRGKYVVCFDP LDGSSNIDCLASIGTIFAIYRKTSEDEPSEKDALQCGRNIVAAGYALYGSATLVALSTGQ GVDLFMLDPALGEFVLVEKDVKIKKKGKIYSLNEGYAKYFDAATTEYVQKKKFPEDGSAP YGARYVGSMVADVHRTLVYGGIFLYPANQKSPKGKLRLLYECNPVAYIIEQAGGLATTGT QPVLDVKPEAIHQRVPLILGSPEDVQEYLTCVQKNQAGS
- Number of residues
- 339
- Molecular Weight
- 36742.84
- Theoretical pI
- Not Available
- GO Classification
- Not Available
- General Function
- Catalyzes the hydrolysis of fructose 1,6-bisphosphate to fructose 6-phosphate in the presence of divalent cations and probably participates in glycogen synthesis from carbohydrate precursors, such as lactate
- Specific Function
- fructose 1,6-bisphosphate 1-phosphatase activity
- Pfam Domain Function
- Signal Regions
- Not Available
- Transmembrane Regions
- Not Available
- Cellular Location
- Cell junction
- Gene sequence
- Not Available
- Chromosome Location
- 9
- Locus
- 9q22.32
- External Identifiers
Resource Link UniProtKB ID O00757 UniProtKB Entry Name F16P2_HUMAN GeneCard ID FBP2 HGNC ID HGNC:3607 PDB ID(s) 3IFA, 3IFC, 4HE0, 4HE1, 4HE2, 5ET5, 5ET6, 5ET7, 5ET8, 5K54, 5K55, 5K56, 5L0A, 5Q0C KEGG ID hsa:8789 NCBI Gene ID 8789 - General References
- Not Available
Associated Data
- Drug Relations
Drug Drug group Pharmacological action? Type Actions Details Fructose-6-phosphate experimental yes target inhibitor Details 2,5-Anhydroglucitol-1,6-Biphosphate experimental yes target inhibitor Details 4-AMINO-N-[(2-SULFANYLETHYL)CARBAMOYL]BENZENESULFONAMIDE experimental yes target inhibitor Details 4-(2-amino-1,3-thiazol-4-yl)phenol experimental yes target inhibitor Details MB-07803 investigational yes target modulator Details